KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334834
Entry
4334834           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit B isoform X1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: Rep_fac-A_C DUF223 REPA_OB_2
Other DBs
NCBI-GeneID: 4334834
NCBI-ProteinID: XP_015631319
LinkDB
Position
3:36082351..36096496
AA seq 691 aa
MAYSGDGIGCCSLLHYAESPMTMARRWFVHFPPFLLQRALVLFFLALPQLIFFSPHGCTA
GLGILCWRFHLGEGVASLVYCSQSSGLLETSCSLQVLLKLLSNSLGQVILRVIVTAFPLL
LSWLRSLFLVHLLRYRSLMSLCRSIQMDYSLLKDVTQESHRWRVRVRATRFSEFTTANEP
DKILRLDLVLLDEQGDMMDAQIPGRRVVQFKPLLKEGAVYYIKYFEVAEARPQYRPVDRL
LMAKFTAHTTVTEDTGPPSTFPSYACKILSFDELRARAYKKDIISDAIGIMTAIGPVQTV
SYAGVMKAVLNDHITNGRETVVVALWGPHATQFHAENLQQQADNGHVVMLFVGLTVKFRD
RQLALQGSTVCRWYPNAPIQETISLISSLHGNPQVVRMIEANFGQKEAINVKVSDICDLN
PHEALGNSYVVNIIIRDLVPAEPWWYIACSTYKRGTAREGNAYKCPRCSTDAIETRYRVV
IMGIDPSDLANDQAKAAEFTFFGEIGEQLIGRPVLNLVASVHGARDIVPPEIKAIFGRQY
VIRTSVSRGSLQRNRVSYQVDSLMLPHPDPSHAICLPSHDTCMGSSGHGSTSANAVEPHA
IVLSSTQSMPPSTPFVLPDTKDTRDSHGDQHEATPPTPQVIAIAHLDKKRKSSMADENLG
HGGSSPDEHDRRKPSVVHTLFVDKLPPELPK
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggcgtacagcggtgacgggattggctgctgctcactgctccactacgcggagagcccc
atgaccatggccaggcgatggtttgtccatttccctccctttcttctacagagagcgcta
gttctattctttcttgctcttcctcagctcatctttttttctccgcacggctgcactgct
ggattggggattctctgttggcgttttcacttgggggagggagttgcctccctcgtctac
tgctcgcaaagttccggattgctcgagacaagctgctctctccaagtgctcctgaaattg
ctatcaaactcattgggtcaggtcattctcagggtgatcgttactgccttcccactgctt
ctaagttggctgcgctcattgttcctggtacatcttctgagatatcgaagtttgatgtcg
ttgtgcagaagcattcagatggattacagtctcctaaaggatgtcacacaggaatcacac
cgttggcgcgtacgagtgcgggcaacccgcttctcggagttcaccacagctaatgagcct
gacaagattttgcgccttgatttagtcctgcttgatgagcagggcgacatgatggatgcg
caaatcccaggacgccgcgttgttcaattcaagcctttgctaaaggaaggcgctgtgtat
tacatcaaatacttcgaagtcgccgaggcacgcccccagtataggcctgttgatcgactg
ttgatggcaaagttcactgctcacacaaccgttacagaagatactggaccaccatccacg
ttcccatcttatgcctgcaaaattctttcttttgatgaactcagagctcgggcttacaag
aaagatattatttcagatgctataggcataatgacagccatcgggccagtgcagactgtt
tcttatgcaggtgttatgaaagctgtgcttaatgaccatataaccaatggaagagaaact
gtcgtcgtggcgttatggggtccccatgctacacaattccacgctgaaaacttgcagcag
caagcagacaatggacatgttgtcatgttatttgttggtttaactgttaaatttcgagac
cgccagctagccctacagggtagcactgtctgtagatggtatcctaacgcaccaatccag
gaaacaatctccctcataagcagccttcacggtaacccacaggtggtcaggatgatagag
gctaacttcggtcaaaaggaagctataaatgtcaaagtttctgatatttgtgaccttaat
ccccatgaggccttgggcaatagctatgttgtcaatataatcatcagggacttggttcct
gctgagccttggtggtatatagcatgcagcacctataagagaggcacagctagagaagga
aacgcatataaatgcccgagatgcagcactgatgcaatagaaacaaggtacagagtagtt
atcatgggtatcgatccatcggatttggcaaacgatcaagccaaagctgctgagtttacc
ttctttggagaaatcggtgaacaattgattggcaggcctgttcttaacctggttgcatct
gttcatggagcacgagatatagtaccaccagagatcaaagcaatttttggcagacaatat
gtcattagaactagtgtgtcacgtggctcattgcaaagaaatcgggtatcctaccaggtg
gattcccttatgctaccccacccagatccaagccatgcaatttgtctacccagccatgat
acttgcatgggctcttctggacatggctcaacatcagctaatgcagttgaaccacatgcc
atcgttttgtcttctactcaatctatgccaccttctacgccgtttgtgcttccagataca
aaggacacaagggacagccatggtgatcagcatgaggcaacaccacctactccacaggtc
atagctatagcacatctagataaaaaacgtaaatcttctatggctgatgagaatcttggc
catggaggctcatctcctgatgaacatgatcgtcgcaagccttctgttgtgcacacactg
ttcgtagacaagctgccaccagagctgccaaaatga

DBGET integrated database retrieval system