KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334913
Entry
4334913           CDS       T01015                                 
Name
(RefSeq) glyoxylate/hydroxypyruvate reductase HPR3
  KO
K15919  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4334913
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4334913
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     4334913
    1.1.1.81  hydroxypyruvate reductase
     4334913
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 Shikimate_DH AdoHcyase_NAD
Other DBs
NCBI-GeneID: 4334913
NCBI-ProteinID: XP_015636155
LinkDB
Position
4:400873..406945
AA seq 369 aa
MIVLYYYYIESTLPKKRVIFYEVQVEWCGGGGAGGKSVSTMASPSGAGKPPAVLLLRPVD
QPFAVALRERYRVLDLLSSGQPLPAFLAAAAAAPDPPRAAVVMGGGSIRADAALFDAVPS
LRCVVSTAAGVDHIDLAECARRGVVVANSGTVYSGDVADHAVGMVIDVMRRVSAAERYVR
RGLWPVQGDYPLGSKVSGKRVGIIGLGNIGSLIAKRLEAFGCVISYNSRNPKRSLPYTYY
ADVRALAADSDVLVVSCALNSETRHIVGGEVLDALGEGGVVVNVGRGANVDEAALVRALR
EGRIAGAGLDVFEGEPKVSPELREMENVVLTPHVAVWTAESRSDLRDHTVANLDAFFSGD
PLLTPVMLP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgatagtactatactactattatatagaaagtactttgccaaaaaaaagagtgatattt
tacgaggttcaagtggagtggtgtggtggaggtggagctggtggcaagtctgtgtcaacc
atggcatcgccctccggcgccggcaagccaccggccgtcctcctcctccggccggtggac
cagcccttcgccgtcgcgctgcgcgagcgctaccgcgtgctcgacctcctctcctccggc
cagcctctcccggccttcctcgccgccgccgccgccgcgcctgacccgccgcgcgccgcc
gtcgtcatggggggcggctcaatccgcgccgacgcggcgctcttcgacgccgtgccttcc
ctgcgctgcgtcgtcagcacggcggccggcgtcgaccacatcgacctcgccgagtgcgcg
cgccgcggcgtcgtcgtggccaactccgggacggtgtactccggcgacgtggccgaccac
gccgtgggcatggtgatcgacgtgatgaggcgcgtgtcggcggcggagaggtacgtccgg
cgagggctctggccggtgcagggggactatcctctcggctccaaggtaagcggcaagcgt
gtgggcatcatcgggcttggcaacatcggttcactgatcgccaagaggctggaagcattc
ggctgcgtcatctcctacaactcaagaaaccccaaacgctcgctcccctacacctactac
gccgacgtccgcgccctcgccgccgactccgacgtgctcgtcgtgtcgtgcgcgctcaac
agcgagacgcgccacatcgtcggcggcgaggtgctggacgcgctcggcgagggcggcgtg
gtggtgaacgtggggcgcggcgcgaacgtggacgaggcggcgctggtgagggcgctgcgg
gaggggaggatcgccggcgccgggctggacgtgttcgagggcgagcccaaggtgtcgccg
gagctgagggagatggagaacgtggtgctgacgccccacgtggcggtgtggacggcggag
tcgaggtccgacctacgtgaccacacggtggccaaccttgacgccttcttctccggcgac
ccgctgctcacgccggtcatgcttccctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334914
Entry
4334914           CDS       T01015                                 
Name
(RefSeq) glyoxylate/hydroxypyruvate reductase HPR3
  KO
K15919  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4334914
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4334914
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     4334914
    1.1.1.81  hydroxypyruvate reductase
     4334914
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored Shikimate_DH IlvN ApbA ThiF
Other DBs
NCBI-GeneID: 4334914
NCBI-ProteinID: XP_015636157
UniProt: Q7XRA4
LinkDB
Position
4:complement(443106..444916)
AA seq 333 aa
MTSAVAAPPATGGKRPVLLLRRINDRLAAELRSRFRVLNFYESSAPLLAFLAAAAAGPDP
PLAAVVVAGGAIQVNAAFLDAVPSLGCVVTTGAGVDHIDLAECARRGVAVAGAGTVFSTD
VADHAVGLLVDVLRRISASDRYVRRGLWAARGDYPLGSKLSGKHVGIIGLGSIGSLIAKR
LQAFGCTISYNSRRPKDSVSYNYFPDVTDLAAASDVLIVACALNDETRHIVDSSVLEALG
KDGVVVNIARGGIVDEAELIRALKEGRIAGAGLDVFEKEPDVPAELLSMDNVVLTAHEAV
FTTESNWDLADLMIANLEAFFSGGPLLTPVLPK
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgacatcagccgtggccgcgccgcctgccaccggcggcaagcgaccggtgcttctgctg
cgccgcatcaacgaccgtctcgcggcggagcttcgctcgcgcttccgcgtcctcaacttc
tacgaatcaagcgctcccctcctcgccttcctcgccgccgccgccgcggggcccgacccc
ccgctcgccgccgtcgtcgtcgccggcggagccatccaggtcaacgccgcgttccttgac
gcggtgccctcccttggctgcgtcgtcaccaccggcgcaggcgtcgaccacatcgacctc
gccgagtgcgcgcgccgcggggtcgcggtggccggcgcaggcacggtcttctccaccgac
gtggcggaccacgccgtcggtctcctcgtcgacgtgctccggcgcatctcggcgtccgac
cggtacgtccgccgcgggctctgggcggcgcgtggggactacccgcttggatccaagcta
agtggcaagcatgtaggtatcatcggcttgggcagcattggatcactgattgcaaagagg
ctccaagcattcggctgcaccatttcctacaactccaggagaccaaaggattctgtctcc
tacaactacttccccgatgtcaccgacctcgccgctgcatccgacgtgctcatcgtcgcg
tgcgcgctgaacgatgagacgcggcacatcgtcgacagtagtgtgctagaagcccttgga
aaagacggcgtcgttgtgaacatcgctcgcggcgggattgttgatgaggcagagctgatc
agggcactgaaggaagggagaattgcaggtgcagggcttgatgtgtttgagaaggagcct
gatgtgccggcagagctcctgtccatggacaatgtggtgctcacggcgcatgaagctgtc
ttcaccactgaatccaactgggacctggccgacctcatgattgcaaacctggaggccttc
ttctccggtggcccattgcttactcctgtacttcccaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334915
Entry
4334915           CDS       T01015                                 
Name
(RefSeq) glyoxylate/hydroxypyruvate reductase HPR3
  KO
K15919  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4334915
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4334915
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     4334915
    1.1.1.81  hydroxypyruvate reductase
     4334915
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 IlvN ApbA NAD_binding_7 TrkA_N Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 4334915
NCBI-ProteinID: XP_015634637
LinkDB
Position
4:445941..447214
AA seq 347 aa
MVDARNHPKRKQQITKKKEREMSSPPVLLLCRLFPGTFTDVAHRFRLLDFYASALPIHAF
LAAVAAHADPPRVVLVFGGGPIPVGAELLDAVPSLRCIITVSAGTNHIDLRECARRGVQV
ANAGGIYSTDVADYAVGLLLDVLRHVSAGDRFVRRGLCPEQRGGDFLPLGSKIGGRRVGI
IGLGSIGSAIARRLEAFGCVVSYHNRRRREDVAYAYFPTATDLAASSDVLVVACALTAET
RRIVDRGVLDALGERGVVVNVARGANVDEAELVRALAEGRVAGAGLEVFDDEPNVPPELW
AMDNVVLTPHQAIFTPESMADLSRVVLANLDAFFAGEPLLTRVEASE
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggtcgatgcccgaaaccacccaaaaagaaagcaacaaatcaccaaaaaaaaagaaaga
gaaatgtcgtcgccgccggtgctcttgctgtgccggctgttcccgggcaccttcaccgac
gtcgcccaccgattccgcctcctcgacttctacgcctccgcgcttcccatccacgccttc
ctcgccgccgtggccgcccacgccgacccacctcgcgtcgtcctcgtcttcggcggcggg
cccatccccgtcggcgccgagctgctcgacgccgtcccctccctccgctgcatcatcacc
gtcagcgccgggaccaaccacatcgacctccgcgagtgcgcgcgccgcggcgtgcaggtc
gccaacgccggcgggatctactccaccgacgtcgccgactacgctgtcggcctcctgctc
gacgttctccgccacgtctccgccggagaccgcttcgtccggcgcggcctctgtccggag
cagcgcggcggcgatttcctccccctcggatccaagatcggcgggaggcgcgtcggcatc
atcggcctcggcagcatagggtcggcgatcgcgaggagactggaggcgttcggctgcgtc
gtctcctaccacaaccgccggcgaagggaggacgtggcctacgcctacttcccgaccgcc
accgacctcgccgcgagctccgacgtgctcgtcgtggcgtgcgcgctgacggcggagacg
cggcgcatcgtggaccggggcgtgctggacgcgctgggggagcgcggcgtggtcgtgaac
gtggcgcgcggcgccaacgtcgacgaggcggagctggtgcgcgcgctggcggagggcagg
gtcgccggcgcggggttggaagtgttcgacgacgagcccaacgtgccgccggagctgtgg
gccatggacaacgtggtgctcaccccgcaccaggccatcttcaccccggaatccatggcc
gacctgagccgcgtcgtcctcgccaacctcgacgcgttcttcgccggcgagccgctgctt
acgcgagtggaagcctcggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334916
Entry
4334916           CDS       T01015                                 
Name
(RefSeq) glyoxylate/hydroxypyruvate reductase HPR3 isoform X1
  KO
K15919  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4334916
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4334916
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     4334916
    1.1.1.81  hydroxypyruvate reductase
     4334916
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored ThiF ApbA NAD_binding_7 Shikimate_DH
Other DBs
NCBI-GeneID: 4334916
NCBI-ProteinID: XP_015633472
UniProt: B9FD17
LinkDB
Position
4:453424..457105
AA seq 320 aa
MAPPATQDGSSSKPIVLLADPLIPEFEQELAPSYRLLPAADADEAAAASARALLTVDLPA
VTAAQIDALPALELVVASSAGVDHINLGACRRRGIAVTNAQNAFSADAADYAVGLLVAVL
RRVAAADAYVRRGAWAAAAGDYPLASKVSGKRVGIVGLGSIGGLVARRLAAFGCVIAYNS
RSPKASAPYKFYPSVRELAAESDVLVLSCALTEETRRMVGREVMEALGKGGVLVNVGRGG
LVDEAELVRCLREGVLGGAGLDVYENEPEVPPELWGMDNVVLSDHRAVITPESIQGVVDV
VKANLDAFFSGKPLVSQVQL
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcgccgccggcgacccaagacggttcttcgtccaaaccgatcgtgctcttggccgac
cctctcatcccggagttcgagcaggagctcgcacccagctaccgcctccttcccgccgcg
gacgccgacgaggccgccgccgcctccgcgagggcgctcctcaccgtggacctccctgcc
gtgaccgccgcacaaatcgacgcgctcccggcgctcgagctggtggtggcgtcgtccgcg
ggcgtcgaccacatcaacctcggcgcatgccgccgccgcgggatcgcggtcaccaatgcc
cagaacgcgttctccgccgacgccgcagactacgccgtcggcctgctcgtggccgtgctc
cgccgagtcgctgccgccgacgcgtacgtcaggcgcggcgcctgggccgccgccgccggc
gattaccctctcgcgagcaaggtgagcggcaagcgggtggggatcgtggggctgggaagc
atcggcggcctggtggcgcggcggctggcggcgttcggctgcgtgatcgcctacaactcg
aggtcaccgaaggcgtcggcgccgtacaagttttaccccagcgtgcgggagctcgccgcg
gagagcgacgtgctggtgctgagctgcgcgctgacggaggagacgcggcgcatggtgggc
cgggaggtgatggaggcgctggggaagggcggcgtgctggtgaacgtggggcgcggcggg
ctggtggacgaggccgagctggtgaggtgcctgcgggaaggggtgctcggcggcgccggg
ctggacgtgtacgagaacgagccggaggtgccgccggagctgtgggggatggacaacgtc
gtgctgtcggaccaccgcgcggtgatcacgccggagtccatccaaggcgtcgtcgacgtc
gtcaaggccaaccttgacgccttcttctccgggaagcctctcgtcagccaagtgcagctc
tga

DBGET integrated database retrieval system