KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334917
Entry
4334917           CDS       T01015                                 
Name
(RefSeq) arginine decarboxylase 2
  KO
K01583  arginine decarboxylase [EC:4.1.1.19]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4334917
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     4334917
SSDB
Motif
Pfam: Orn_Arg_deC_N
Other DBs
NCBI-GeneID: 4334917
NCBI-ProteinID: XP_015633833
UniProt: Q7XRA1
LinkDB
Position
4:463662..467284
AA seq 623 aa
MAKKNYGQVYNILGWGDPYFTVNSHGHLAVKPHGRDTMSGQDIDVHSVIHRALATTITTN
DGDKKPQFPMILRFPDVLKNRLDSLHAAFHGAVDSTGYASRYQGVFPIKVNQNKAVVQDL
VTFGHGYSYGLEAGSKPELLIAMSCLAKAKPGAYLVCNGYKDADYVALALSARAMGLNAI
IVLEMEEELDIVVEQSARLGVEPVIGVRAKLLTKIPGHFGSTAGKHGKFGMLADKIYEVA
GKLKKMGKLHWLKLLHYHVGSMIPTTDIVYNAAAEAAGIYCALVKEHGATGMTTLDCGGG
LGVDYDGTRSGSSDMSVAYGLEQYASSIVQAVRLTCDDNGVPHPVLCTESGRAMASHHSM
IILEALSAIPEPQDEEDTHHRLLSKIQDLSSKQPRTAHTVNGGGGVDAMHSHAVELKKHG
IEMYKLAKKLSKRVTGDANGIYNYHMNLSVFSLVPDFWGIGQLFPMMPVSRLNEKPTING
TLVDITCDSDGKVEKFIRDAVTLPLHPLDDAAAEHGGYYVAALLSGAYQEALACKHNLFS
GPTLVRVESAGGGGAFKIVSVELGPTAEEVIGTMRYDVKNDISDVIEKVATENGVWPMVE
PLMKKGLTTMPYLNDYKPPKTTF
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggcgaagaagaactacggtcaagtgtacaacatcctcgggtggggcgacccctacttc
accgtgaactcccatggccacctcgccgtcaagccccatggccgcgacaccatgtccggc
caggacatcgacgtccactccgtcatccacagagctctcgccaccaccatcaccaccaac
gacggcgacaagaagccccagttcccgatgatcctccgcttccccgacgtgctcaagaac
cgcctcgactccctccacgccgccttccatggcgccgtcgacagcaccggctacgcgtcc
aggtaccagggcgtgttccccatcaaggtgaaccagaacaaggccgtcgtccaggacctc
gtcaccttcggccatggctacagctacggcctcgaggctggctccaagccggagctgctc
atcgccatgagctgcctcgccaaggccaagcccggagcttacctggtctgcaatggctac
aaggacgccgactacgtcgcgctcgcgctctccgcgcgcgccatgggcctcaacgccatc
atcgtgctggagatggaggaggagctcgacatcgtcgtcgagcagagcgccaggctcggc
gtcgagccggtcatcggcgtccgcgccaagcttctcaccaagattccgggacacttcggc
tccacggccggcaagcacggcaagttcgggatgctcgccgacaagatctacgaggtggcc
ggcaagctgaagaagatggggaagctgcactggctgaagctgctgcactaccatgtcggc
tccatgatcccgaccaccgacatcgtgtacaacgcggcggccgaggccgcaggaatctac
tgcgcgctggtgaaggagcacggcgcgacggggatgaccacgctggactgcggcggcggg
ctcggcgtcgactacgacgggacgcggtcgggcagctccgacatgtcggtggcgtacggg
ctcgagcagtacgcgtccagcatcgtgcaggcggtgcggctcacgtgcgacgacaatggc
gtcccccacccggtgctctgcaccgagagcggccgcgccatggcgtcgcaccactccatg
atcatcctcgaggcgctctcggcgatcccggagccgcaggacgaggaggacacccatcac
cggctgctcagcaagatccaggacctctcctccaagcagccaagaactgctcataccgtc
aatggcggcggcggcgtggacgccatgcactcgcacgccgtggagctgaagaagcacggg
atcgagatgtacaagctggcgaagaagctgtccaagagggtgaccggcgacgccaacggc
atctacaactaccacatgaacctctccgtcttctccctcgtccccgacttctggggcatc
ggccagctcttcccgatgatgccggtgagccggctgaacgagaagccgaccatcaacggc
acgctggtcgacatcacctgcgacagcgacggcaaggtagagaagttcatccgcgacgcc
gtgacgctgccgctgcacccactcgacgacgcggcggcggagcacggcggctactacgtg
gcggcgctgctgtcgggggcgtaccaggaggccctggcgtgcaagcacaacctgttcagt
ggccccacgctcgtgcgcgtcgagagcgccggcggcggcggcgcgttcaagatcgtctcc
gttgagctcggcccgacggcggaggaggtcatcggcacgatgaggtacgacgtgaagaac
gacattagcgatgtgatcgagaaggttgcgacggagaatggcgtgtggccgatggttgag
ccgctgatgaagaaagggctgaccaccatgccctacctcaacgattacaagccccccaaa
accaccttttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340008
Entry
4340008           CDS       T01015                                 
Name
(RefSeq) arginine decarboxylase 1
  KO
K01583  arginine decarboxylase [EC:4.1.1.19]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4340008
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     4340008
SSDB
Motif
Pfam: Orn_Arg_deC_N
Other DBs
NCBI-GeneID: 4340008
NCBI-ProteinID: XP_015643038
UniProt: Q9SNN0
LinkDB
Position
6:complement(1674319..1677424)
AA seq 702 aa
MPALAVDAAAPVAHAFACDAARFPAPLLGPAAAAAAVAEKPDAAAWSADLSSALYNVDGW
GAPYFFVNDDGDVAVRPHGAATLPGQEIDLAKVVAKAAGPRSGGGLGLPLPLLVRFPDVL
RHRVEALNAAFDYAVRSTGYGGRYQGVYPVKCNQDRHVVEDIVEFGEPFRFGLEAGSKPE
LLLAMSCLAARGNPDALLICNGYKDDEYVSLALIARTMGLNTVIVLEQEEELDIVVDASR
RLGVRPVVGMRAKLRTKHAGHFGSTSGEKGKFGLNAAQILSVVAKLKTLGMLDCLQLLHF
HIGSQIPTTALLGDGVGEAAQIYCELARLGAAMRVIDVGGGLGIDYDGSHSAQTDMSVAY
SLEEYAAAVVAAVGRVCDRKGVAHPIICSESGRALVSHHSVLVFEAFSASAPGRIDPATG
YLLDELTDDCHADYRNLMAAAVRGDFDTCALYADQLKRRCADQFKDGVLGLEHLAAVDSL
CEIVARGMGAAEPPRTYHINLSVFTSLPDMWAIGQMFPIIPIQRLGERPAVDGVLSDLTC
DSDGKVDHFIGGRHSLPLHELPVHGTRGYYLGMFLGGAYQEALGGLHNLFGGPSVVRVSQ
SDGPHCFAVTRAAAGPSCADVLRSMQHEPEVMFEVLKQRTDGATAAALARAFGAMPYLSF
DPEAAAMASGESSGMSSDSEGSAAGAAEEDDDEWEFMRGLTV
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgcctgcgctcgccgtggacgccgctgcacctgtcgcgcacgccttcgcgtgcgacgcg
gcgcgcttccccgcgccgctgctgggccccgccgccgcggctgcggcggtggcggagaag
ccggacgcggccgcgtggtcggccgacctctcgtccgcgctgtacaacgtggacggctgg
ggcgcgccgtacttcttcgtcaacgacgacggcgacgtcgccgtgcgcccgcacggcgcc
gcaaccctgcccgggcaggagatcgacctcgccaaggtggtggccaaggccgccggcccg
cgctccggcggcgggctcggcctgccgctccccctgctggtgcggttccccgacgtgctc
cgccaccgcgtggaggccctgaacgcggcgttcgactacgccgtgcgctccaccggctat
ggcgggaggtaccagggcgtgtaccccgtcaagtgcaaccaggaccgccacgtcgtggag
gacattgtggagttcggcgagccgttccgcttcggcctggaggccggctccaagcccgag
ctgctgctcgccatgagctgcctcgccgcgcgcggcaacccggacgccctgctcatctgc
aacggctacaaggacgacgagtacgtctcgctcgcgctcatcgcgcgcaccatggggctc
aacacggtcatcgtgctcgagcaggaggaggagctcgacattgtggtcgacgctagccgc
cgcctcggcgtgcgcccggtggtcggcatgcgcgccaagctgcgcaccaagcacgccggc
cacttcggctccacgtccggggagaagggcaagttcggcctcaacgccgcgcagattctc
tccgtcgtcgccaagctcaagacccttggtatgctcgactgcctccagctcctgcacttc
cacattggctcccagatcccgaccactgctctgctcggcgatggcgtcggggaggccgcg
cagatctactgcgagctcgcccgcctgggcgcggccatgcgcgtcatcgacgttggtgga
ggcctcggcattgactacgacgggagtcactcggcgcagaccgacatgtccgtggcatac
agcttggaggagtacgcggcggccgtggtggccgccgtcggccgcgtctgtgaccgcaag
ggcgtcgcgcatcccatcatctgcagcgagagcggccgcgcgctggtgtcgcaccactct
gtcctggtgttcgaggccttctcggcttcggcgcccggccgcattgacccggccacgggc
tacctgctcgacgagctcaccgacgactgccacgccgactaccgcaacctcatggccgcc
gcggtgcgcggcgacttcgacacctgcgctctgtacgccgaccagctgaagcggcgctgc
gccgatcagttcaaggacggcgttcttggcctggagcacctcgccgcggtggacagcctc
tgcgagatcgtcgcccgcggcatgggcgccgccgagccgccgcgcacgtaccacatcaac
ctgtccgtgttcacctccctgccggacatgtgggcgatcgggcagatgttcccgatcatc
ccaatccagcgcctcggtgagcgccctgcggtcgacggcgtcctctccgacctcacctgc
gacagcgacggcaaggtcgaccacttcatcggcgggaggcacagcctgccgctgcacgag
ctccccgtccacggcacccgcggctactacctcggcatgttcctcggcggcgcctaccag
gaggccctcggcggcctccacaacctgttcggcgggccgagcgtggtgcgcgtgtcgcag
agcgacgggccgcactgcttcgccgtcacgcgcgcggcggcggggccgtcgtgcgccgac
gtgctccgctcgatgcagcacgagcccgaggtgatgttcgaggtgctcaagcagaggacc
gacggcgccaccgccgccgcgctcgccagggcgttcggcgcaatgccgtacctgtcgttc
gacccggaggccgcggcgatggccagcggggagagcagcggcatgagcagcgactcggag
gggtcggccgccggcgcggcggaggaggatgacgacgagtgggagttcatgcgggggctc
accgtgtga

DBGET integrated database retrieval system