KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334956
Entry
4334956           CDS       T01015                                 
Name
(RefSeq) amidase 1
  KO
K01426  amidase [EC:3.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4334956
   00360 Phenylalanine metabolism
    4334956
   00380 Tryptophan metabolism
    4334956
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     4334956
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 4334956
NCBI-ProteinID: XP_015635919
UniProt: A3AQC6 A0A0P0W696
LinkDB
Position
4:1054600..1070890
AA seq 434 aa
MAEDFGAFMERFVLPPPPPPSSQQLPLHGLTFAIKDIFDIAGRVTGFGNPDWARTHAPAA
ATSPVVLAALAAGATSLGTTIMDEMAYSIYGENAHYGTPANPCAPGRVPGGSSSGSAVAV
AANLVDFSLGTDTGGSVRVPAAYCGIFGLRTSHGLVSAQNVIPMAQMFDTVGWFARDLST
LSRVTKVLLPLPDDTVKHPTHVTIPMDCFQILGSPDDHTYQIVNASVAKKFGSHAIDNAN
LGDFVSDNVPSIGKFIADFSESELPSVPALSVISHVMFSLLRSQFKANHAEWVNSVKPNL
GPGLRENIHGAVASGDDEPLEEFLAVRAEFKSALAALLKDHGILAIPTVPGPPPMVGIQA
QAAPLDNYQARAFSLLDIAVVSGFCQVSIPLGKRNGLPVSVSLVARHGADHFLLNVAEEL
YQTLIDEAAKAWAS
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggcagaagacttcggcgccttcatggagaggttcgtgctgccgccgccgccgccgccg
tcgtcgcagcaactccccctgcacggcctcaccttcgccatcaaggacatcttcgacatc
gccggccgcgtcaccgggttcggcaacccggactgggcgaggacccacgcgcccgccgcc
gccacctcccccgtcgtcctcgccgcgctcgccgccggcgccaccagcctcggcaccacc
atcatggacgagatggcatacagcatctatggcgagaacgcgcactacggcacgccggcc
aacccgtgcgcccccggcagagtccccggcggatcctccagtggctccgccgtcgccgtc
gccgccaacctcgtcgacttctccctcggcaccgacaccggcggcagcgtcagggtgccc
gctgcctactgcggcatcttcggcctccgcacctcccatggcctcgtttccgctcaaaac
gtcatccccatggcacaaatgtttgatactgttggttggtttgccagagatctatctacg
ttgtctcgtgtaaccaaagtgttgttgccacttcctgatgacactgtcaagcacccaact
catgtcacaattcccatggactgtttccaaatcttagggtctcctgatgaccatacatat
caaatcgtcaatgcttcagtagccaagaaatttggtagtcacgcaatagacaatgccaac
cttggagacttcgtctctgacaatgttccaagcatagggaagttcattgctgacttctct
gaaagcgaactaccttccgtgccagctctctctgtcatttcacatgtcatgttcagcctt
ctgaggtctcagttcaaagcaaaccatgcagagtgggttaactctgtaaaacctaaccta
ggccctggattacgagagaacatacatggggccgttgcatcaggggatgatgaacccctg
gaggaatttctagccgtaagggccgaattcaagtctgcacttgctgctcttctcaaggat
catggaatccttgcgattcctacggttcctggccctccaccaatggtgggcattcaggcg
caggctgctcctctggataattaccaagcaagagcattttcccttctcgacatcgctgta
gtatccgggttttgccaggtgagtattccactgggcaagcgcaatggtcttcctgtgtca
gtttcgctggtggcacgacatggcgcagaccatttcctcctcaatgtggctgaggagctg
taccagacgctcatagacgaagccgctaaagcttgggcctcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334958
Entry
4334958           CDS       T01015                                 
Name
(RefSeq) amidase 1
  KO
K01426  amidase [EC:3.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4334958
   00360 Phenylalanine metabolism
    4334958
   00380 Tryptophan metabolism
    4334958
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     4334958
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 4334958
NCBI-ProteinID: XP_015635920
UniProt: Q7XTK3
LinkDB
Position
4:1073398..1076455
AA seq 435 aa
MAMAGGGRGDYGAFMERFVLPPPPSQQLPLHGLTFAIKDIFDIAGRVTGFGNPDWARTHA
PAAATSPVVLAALAAGATSLGTTIMDEMAYSINGENTHYGTPTNPCAPGRVPGGSSSGSA
VAVAANLVDFSLGTDTGGSVRVPAAYCGIFGLRPSHGLVSAENVIPMAQMFDTVGWFSRD
LSTLSRVTKVLLPLPDDIVKQPTQVTIPMDCFQILGSLDDRTYQIINASVAKRFDSQILD
NRNLGDFISDNVPSIGKFITDFSESELPSVPALSVISHVMRGLQRSQFKANHAEWVNTVK
PNLGPGLRERILEAIASGDNESLEDFQAIRAEFKSALAALLKDHGILAIPTVPGPPPKVG
MEAAPLENFRARAFSLLSIAGLSGFCQVSIPLGMRNGLPVSVSLVARHGADHFLLNVVEE
LYQTLIDEATKTWSS
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcgatggcgggtggaggacgaggagactacggcgccttcatggagaggttcgtgctg
ccgccgccgccatcgcagcaactccctctccacggcctcaccttcgccatcaaggacatc
ttcgacatcgccggccgcgtcaccgggttcggcaacccggactgggcgaggacccacgcg
cccgccgccgccacctcccccgtcgtcctcgccgcgctcgccgccggcgccaccagcctc
ggcaccaccatcatggacgagatggcctacagcatcaatggggagaacacgcactacggc
acgccgaccaacccttgcgcgcctgggagagtccccggaggatcctccagtggttcagct
gtcgccgtcgccgccaacctcgtcgacttctccctcggcaccgacaccggcggcagcgtc
agggtgcctgctgcctactgcggcatctttggactccgcccttcccatgggttggtttct
gcagagaatgtcatccccatggcgcaaatgtttgatactgttgggtggttttccagagat
ttatctacgttgtctcgtgtaaccaaagtgctgttgccactccctgatgacattgtcaag
caacctactcaagtcacaattcctatggactgtttccagatcttaggctctctcgacgac
cgcacctatcaaatcatcaatgcttcggtagcaaagagatttgatagtcagatattagac
aataggaaccttggagatttcatctctgataatgttccaagcataggaaagttcatcact
gacttctctgaaagcgaactcccttctgtgccagctctatccgtcatttcacatgtcatg
cgaggccttcaaaggtctcagttcaaagcaaaccatgcagagtgggtcaacactgtaaaa
cctaacctaggccctggattacgggagagaatactggaggccattgcatctggggataat
gaatccctggaggatttccaagctataagggctgaattcaagtctgcacttgctgctctt
ctgaaggatcatggaatccttgcaatccctacagttcctgggcctccacccaaggtgggc
atggaagctgctcctctggaaaatttccgagcaagagcattttcacttctctccatcgct
ggattatccgggttttgccaggtgagtattccgctgggcatgcgcaatggtcttcctgtg
tcagtttcgctcgtggcgcgacatggtgcagaccatttcctcctcaatgtggttgaggag
ctgtatcagacactcatagacgaagccactaaaacttggtcctcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335103
Entry
4335103           CDS       T01015                                 
Name
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4335103
   00360 Phenylalanine metabolism
    4335103
   00380 Tryptophan metabolism
    4335103
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     4335103
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 4335103
NCBI-ProteinID: XP_015635147
UniProt: Q7XMY3
LinkDB
Position
4:5643920..5649762
AA seq 507 aa
MARQPALVVVVVAAVALAGGGSLGFEFHEATVDAIQLGFSNGSLTSTALVRFYLDRIARL
NTLLHAVIEVNPDALAQAARADAERATGHRCGPLHGVPVLLKDIIATRDRLNTTAGSLSL
LGAVARRDAGVVARLRRAGAVVLGKANLPEWANFRSSPGLRGWSARGGQSRNPYVLSADP
CGSSTGPAIAAAANMAAVTVGTETTASILCPAAANSVVGIKPTVGLTSRSGVIPFTTRQD
TVGPLCRTVADAVHVLDAIVGYDALDAKATKAASKYIPAGGYVQFLRIDGLKGKRIGIPD
GFFDFPNGTVRKMVYKQHLNTMRQQGAVVIENLEIANLSVIFDGTKSGLLTALLAEFKLN
LNNYLSDLSYSPVRSLAEIIAFNNAHPVEEELKEHGQSILLMSENTAGIGPAEKAAIRRL
NELSVNGVEKLMNDHQLDAIVTPDSAAAVVLAFHGLPGVVVPAGYDEKGVPFGVCFGGLK
GYEPRLIEMAYAFEQVTKVRMPPMFKP
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggctcggcagcccgcgctcgtcgtcgtcgtcgtcgcagctgtcgcgctcgccggcggc
ggctcgctcggcttcgagttccatgaggccaccgtcgacgccatccagctcggcttcagc
aacggcagcctcacctccacggcgctcgtccgcttctacctcgaccgcatcgcccgcctc
aacacgctcctccacgccgtcatcgaggtcaaccccgacgcgctcgcccaggcggcgcgc
gccgacgccgagcgcgccaccggccaccgttgcggcccgctccacggcgtgcccgtcctc
ctcaaggacatcatcgcgacgcgcgaccggctcaacacgacggccgggtcgctgtcgctg
ctcggcgcggtcgccaggcgcgacgccggcgtggtggcccggctgcggcgcgccggcgcc
gtcgtgctcggcaaggccaacctccccgagtgggccaacttccgcagctcgccgggtctc
cgcggctggagcgcacgcggcggccaatcccggaatccatacgtgctctcggccgatccg
tgcgggtcgagcaccggtccggcgatcgccgcggcggcgaacatggcggcggtgacggtg
gggacggagacgacggcgtcgatcctgtgcccagcggcggcgaactcggtggtggggatt
aagccgacggttgggttgacaagccggtcaggtgttatcccgttcacaactaggcaggac
accgtcggaccgttatgtcgaacagtggcagatgctgtccatgtgttggatgctattgtg
ggttatgatgctcttgatgccaaagccacaaaagcagcatcgaagtatatccctgctggt
ggatatgtgcaattcttgagaattgatgggttgaagggtaagaggattggcataccagac
ggtttttttgatttcccaaatggaactgtcaggaagatggtgtacaagcaacacctcaac
acaatgaggcaacagggtgcagttgtaatcgaaaacctcgagatagctaatttgagtgtc
atattcgatggcactaaaagtggattgctcaccgcattgctggccgagttcaagctaaac
ctgaacaactatctgtcagacttatcatactcgccagttcgttctctcgctgaaataatt
gcattcaacaatgcacatcctgtcgaagaggagctgaaagagcatggacagagcatcttg
ctgatgtctgaaaacacagccgggatcggccctgcagagaaggctgcgatccgtcgtctc
aacgagctgtcagtgaatggggtcgagaagctcatgaacgatcatcagctggacgccatc
gtgacgccggactccgccgccgccgtcgtcctcgccttccatggcctccccggcgtggtt
gtgccggcagggtacgacgagaaaggagtcccctttggtgtctgcttcggtggattgaag
gggtacgagccgaggctaattgagatggcttatgccttcgagcaggttaccaaagtgaga
atgcctccaatgttcaagccatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335106
Entry
4335106           CDS       T01015                                 
Name
(RefSeq) putative amidase ARB_02965
  KO
K01426  amidase [EC:3.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4335106
   00360 Phenylalanine metabolism
    4335106
   00380 Tryptophan metabolism
    4335106
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     4335106
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 4335106
NCBI-ProteinID: XP_015633987
LinkDB
Position
4:5686410..5689478
AA seq 515 aa
MAQLRLPLAAATMALAAAAAAAFCCCCSAATGFEFNEATVDAIQLGFSNGSLTSTTLVRF
YLDRIARLNPLLHAVIEVNPDALAQAARADAERATGRRCGPMHGVPVLLKDNMATRDRLN
TTAGSLALLGSIVRRDAGVAARLRAAGAVILGKASLSEWSNFRPVKSGWSARGGQTVNPY
VLSADPCGSSSGPAVAAAANMAAVTLGTETDGSILCPASLNSVVGIKPTVGLTSRAGVIP
ISPRQDTVGPICRTVSDAAHVLDVIVGFDELDAEATGAASKYIPSGGYGRFLRMDGLKGK
RIGIPNGFFTEGAYGKTQLRVYQKHLSTMRKHGALVIENINITTNLSAAQDVLYSNENIA
LQAEFKLSLNAYLSDLLYSPVHSLADVVAFNNAHPVEERLQDFGQPDLIAAQKTNGIGPV
EKAAIQRLNELSADGLENLMRMHQLDAIVTPNSHASSFFAIGGMPAITVPAGYDGHGVPF
GICFGGLKGYEPRLIEMAYAFEQATKVRRMPSFKP
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggctcagctccggctgccactggccgcggccaccatggctctcgccgccgccgccgcc
gccgccttctgctgctgctgctccgccgccactggcttcgagttcaacgaggccaccgtc
gacgccatccagctcggcttcagcaacggcagcctcacctccacgacgctcgtccgcttc
tacctcgaccgcatcgcccgcctcaacccgctgctgcacgccgtcatcgaggtcaacccc
gacgcgctcgcccaggcggcgcgcgccgacgctgagcgcgccaccggtcgccgctgcggg
ccgatgcacggcgtgcccgtcctgctcaaggacaacatggcgacgcgcgaccggctcaac
acgacggccgggtcgctggcgctgctcggctccatcgtgcgccgcgacgccggcgtggcg
gcccgcctccgcgccgccggcgccgtcatcctcggcaaggccagcctctccgagtggtcc
aacttccgccctgtcaaatccggctggagcgcccgcggcggccagacggtgaatccctac
gtgctctcggctgacccgtgcgggtcgagcagcggtccggcggtggcggcggcggcgaac
atggcggcggtgacgctgggaacggagaccgacgggtcgatactttgcccggcgtcgctg
aattcggtggtcggaattaagccgacggttgggctcaccagccgggctggtgtcatcccc
atctcccccagacaagacactgttgggccaatatgtcgtacggtgtcggacgctgcccat
gtgttggatgtcattgttgggttcgatgagcttgatgctgaagcgactggagcagcatcc
aaatacatccctagtggtggatatggacgattcttaaggatggatggattgaaaggcaag
aggattggcatccccaatggctttttcactgaaggagcctatgggaagacacaactgagg
gtgtaccaaaaacatctttccactatgaggaaacacggagccctggtgatagagaatatc
aacatcacaacaaatttgtctgccgcgcaggatgttctttattccaacgagaatatcgca
ttgcaagcagagttcaagttaagcctaaacgcttatttgtcagacttgctgtattcccca
gttcattccctcgccgatgtggtagcattcaataatgcacatcctgtggaggagagactt
caagattttggccagcccgacctgattgcagctcaaaaaaccaatggcattggtccagtg
gaaaaagcggcaatccagcgtctcaacgagctgtcagctgatggattggagaatctgatg
aggatgcaccagctagatgcgattgtcacccccaactctcatgcatctagcttttttgcc
atcggcggcatgcccgcgatcaccgtgccggctgggtacgatggtcatggagtaccattt
ggtatctgcttcggtgggttgaagggctatgaaccgaggctgattgaaatggcttatgct
tttgagcaagctaccaaagttcgaaggatgcccagcttcaagccatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335108
Entry
4335108           CDS       T01015                                 
Name
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4335108
   00360 Phenylalanine metabolism
    4335108
   00380 Tryptophan metabolism
    4335108
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     4335108
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 4335108
NCBI-ProteinID: XP_015633994
UniProt: B7ETP8
LinkDB
Position
4:5728012..5731930
AA seq 504 aa
MAQRRLLLAIMALAAVAAATGFEFHEATVDAIQLGFSNGSLTSTALVRFYLDQITRLNPL
LHAVIEVNPDALAQAARADDERATGRRCGPLHGVPVLLKDNIATRDRLNTTAGSFALLGS
VVPRDAGVAARLRAAGAVILGKASLTEWSAYRPAPNGWSARGGQTLNPYVRSFTPCGSSS
GSAVAAAANMAAVTLGTETDGSILCPASLNSVVGIKPTVGLTSRAGVVPISPRQDSVGPI
CRTVSDAVHVLDAIVGYDALDAEATGAASKYIPNGGYGQFLRMDGFKGKRIGIPNGFFTQ
EIFEKKQLRAYQKHIQLMRKHGAMVIENIDIAKNLTEVQNVLFSNEHIAMIAEFKLSLNA
YLSDLLYSPVRSLADVIAFNKAHPVEERLKDFGQPYFIEAEKTNGIGPVEKASIQHLNKL
SADGLEKLMRMHQLDAIVTPNDNGRVFFAVSGMPAITVPAGYDSQGVPFGTCFGGLKGYE
PRLIEMAYAYEQATKVRMMPGFKM
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggctcagcggcggctgctactcgccatcatggctctcgccgccgtcgccgccgccacc
ggcttcgagttccacgaggccaccgtcgacgccatccagctcggcttcagcaacggcagc
ctcacctccacggcgctcgtccgcttctacctcgaccagatcacccgcctcaacccgctc
ctccacgccgtcatcgaggtcaaccccgacgcgctcgcccaggcggcgcgcgccgacgac
gagcgcgccaccggtcgccgctgcgggccgctccacggcgtccccgtcctgctcaaggac
aacatcgcgacacgcgaccggctcaacacgacggccgggtcgttcgcgctgctcggctcc
gtcgtcccccgcgacgccggcgtggcggctcgcctccgcgccgccggcgccgttatcctc
ggtaaggccagcctcaccgagtggtccgcttaccgccccgccccgaacggctggagcgcc
cgcggcggccagacactgaatccgtacgtgcgctcgttcaccccgtgcggatcgagcagc
ggttcggcggtggcggcggcggcgaacatggcggcggtgacgctggggacggagaccgac
gggtctatactgtgcccagcgtcgctgaattcggtggtcgggattaagccgacggttggg
ctcaccagccgcgccggcgtcgtccccatctcccctcgacaggacagtgttgggccaata
tgtcggacagtgtcggatgctgtccatgtgttggatgccattgttgggtatgatgcactt
gacgctgaagccactggagcagcatccaagtacattcctaatggtggatatggacaattc
ttaaggatggatggattcaaaggcaagaggattggtattcccaacggcttcttcactcaa
gaaatatttgagaagaaacagctgagggcataccaaaaacatattcaattaatgaggaaa
catggagccatggtgattgagaacatcgacatcgcaaaaaatctgactgaagtacagaat
gttcttttttccaacgagcatatcgcaatgatagcagagttcaagttaagcttgaatgct
tatttgtccgacttgttgtattccccagttcgttcccttgcagatgtcatagcattcaac
aaggcacatccggtggaggagaggcttaaagattttggacaaccctattttattgaagcc
gaaaagaccaacggcattggaccggtggagaaagcttcaatccaacatctcaataagctg
tctgctgatgggctggagaagttgatgaggatgcaccagttggatgcgattgtcacgccc
aatgacaacgggagagtcttcttcgccgtcagtggcatgccagcgatcaccgtgccggct
gggtacgacagtcaaggagtgccatttggtacttgcttcggtggattgaagggctatgag
ccaaggctgattgaaatggcctatgcttatgagcaagctaccaaagttcgaatgatgcct
ggcttcaagatgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335110
Entry
4335110           CDS       T01015                                 
Name
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4335110
   00360 Phenylalanine metabolism
    4335110
   00380 Tryptophan metabolism
    4335110
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     4335110
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 4335110
NCBI-ProteinID: XP_015634716
LinkDB
Position
4:5739136..5782412
AA seq 508 aa
MSHLPLQLAAAIMALAAAATACRAFQIEEATFDAIQLGFSNGSLTSTALVRFYLDRVARL
NPLLHAVIEVNPDALAQAARADAERASGRRGFGPLHGVPVLLKDNIATRDRLNTTAGSLA
LLGSVVRCDAGVAARLRAAGAVILGKSNPAEWSSFRPLTNGWSARGGETLNPYVVTATPC
WSSSGSAVAAAANMAAVTLGTETDGSIICPASWNSVVGIKPTVGLTSRAGVIPITPRQDT
VGPICRTVSDAVHVLDNIVGYDALDAEATGASSKYIPPGGYGHFLRMDGLKGKRIGIPNG
FFTKEKYGKKQLMVYQKHVALMREHGAMVIENIGTTENQTEVKNHLFEIDLVAMKAEFKL
SLNAYLSDLLYSPVRSLADVIAFNNAHPVEERLKDFGQSFLTDSQKTNGIGPREKTVLKI
LKEISTDVLEKLMKKHQLDAIVTPNSDASTIFAIGGMPAIAVPAGYDNQGVPFAICFGGL
KGYEPRLIEMAYAFEQATKVRRMPRYKH
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtctcacctgccgctgcaactcgccgccgctatcatggcgctcgccgccgccgccacc
gcctgccgagcgttccagatcgaggaagccaccttcgacgccatccagctcggcttcagc
aacggcagcctcacctccacagcgctcgtccgcttctacctcgaccgcgtcgcccgcctc
aacccgctgctgcacgccgtcatcgaggtcaaccccgacgcgctcgcccaggcggcgcgc
gccgacgccgagcgagcctccggccgccgtggcttcgggccgctgcacggcgtccccgtc
ctcctcaaggacaacatcgcgacgcgcgaccggctcaacacgacggccgggtcgctggcg
ctgctcggctccgtcgtccgctgcgacgccggcgtggcggcccgcctccgcgccgccggc
gccgtcatcctcggcaagtccaaccccgccgagtggtccagcttccgtcccttgacgaac
ggctggagcgcacgcggcggcgagacgctgaacccgtacgtggtcacggctaccccgtgc
tggtcgagcagcggttcggcggtggccgcggcggcgaacatggcggcggtgacgctgggg
acggagacagatgggtcgataatctgcccggcgtcgtggaattcggtggtcgggattaag
ccgacggtgggtctcaccagccgggccggcgtcatcccgatcacccctcgacaggacacc
gttgggccaatatgccgtacagtgtcggatgctgtccatgtactggataacattgttggg
tatgatgcacttgatgctgaagccactggagcatcatccaagtatatcccacctggtgga
tatggacacttcttaaggatggatggattgaagggcaagaggattggtattcccaatggc
tttttcactaaagaaaaatatgggaagaaacaattgatggtataccaaaaacatgttgca
ttaatgagggaacatggagccatggtgatagagaatatcggcaccacagaaaatcagact
gaagtaaagaatcatcttttcgaaattgatcttgtcgctatgaaagcagagttcaagtta
agcttaaatgcttatttgtcagacttgctgtactccccagttcgttctcttgcagatgtc
atagcattcaacaatgcacatcctgtggaggagaggcttaaagattttggacagagcttt
cttactgattcccaaaaaaccaatggcattggacccagggagaaaactgtactcaagata
ctcaaagagatatctactgatgtgttggagaaactgatgaagaagcaccagttggatgcg
attgtcacacccaactctgacgcctccaccattttcgccatcggcggcatgccggcgatc
gctgtaccagctgggtatgacaatcagggagtgccatttgctatctgcttcggtggattg
aagggctacgagccgaggcttatcgaaatggcctatgcttttgagcaagctaccaaagtt
cgaaggatgccacgttacaagcactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348137
Entry
4348137           CDS       T01015                                 
Name
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4348137
   00360 Phenylalanine metabolism
    4348137
   00380 Tryptophan metabolism
    4348137
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     4348137
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 4348137
NCBI-ProteinID: XP_015614363
LinkDB
Position
10:3469076..3475363
AA seq 523 aa
MLPSAAPARCLLLLLLLAVAVAGAAFDLEEATVDSIRRAFADGELTSRGLVELYLSRAAA
LDPSLHAVVELDPDGALAAADRADDARRLFASAGGGALPPPLLNGIPVLVKDNIAAAGGG
GALNATCGSLALVGSRPAGDAGVVERLRRAGAVVLGTASLSEWCNFRAPGIPAGWSPRAG
QGKNPYVPSATPCASSSGSAIAAAANMVAVTIGTETDGSIMCPSSYNSVVGIKPTVGLTS
RAGVIIISPRMDTVGPICRTVSDAVHVLEAIVGYDPRDAEATRMALQYIPEDGYRQFLNI
DGLRGKRLGILRKDFFRFPSGSVQQKVFDEHFNTISKMGAILVDNLEIPNMNIINDAVQS
GERALMLAEFKLSLNSYLSELASSPVRSLSDIIDFNNKHPVEERMAEFGQSYLLQSEATD
GTGPTEKKAIAKLNELCESGLEKIMRVNQLDAIVSPGASAHSLLAIGGYPAITVPAGYAS
NGVPFAICFGGLKGSEPRLIEIAYSFEQATKVRRPPTLQHSII
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgctgccctccgccgcgcccgcgcgctgcctcctcctcctcctcctcctcgccgtcgcc
gtcgccggcgccgcgttcgatctcgaggaggccacagtcgactccatccgccgcgccttc
gccgacggggagctcacctcgcgcggcctcgtcgagctctacctaagccgcgccgcggcg
ctcgacccgtccctccacgccgtcgtcgagctcgacccggacggcgcgctcgccgcggcc
gaccgcgccgacgacgcccgccgcctcttcgcgtccgcgggaggaggcgcgctcccgccg
ccgctgctgaacggcatccccgtcctcgtgaaggacaacatcgccgcggccggcggcggc
ggcgcgctgaacgcgacgtgcggctcgctcgccctggtcgggtcgcgccccgcgggcgac
gccggggtggtcgagcggctccggcgcgccggcgcggtggttcttggcacggccagcctc
agcgagtggtgcaacttccgcgcccccggcatccccgccggctggagcccccgcgccggc
cagggcaagaatccctatgtgccatcggcgacgccgtgcgcgtcgagcagtggctcggcg
attgcagcggcggcgaacatggtggcggtgacgattgggacggagacggacgggtcaatc
atgtgcccgtccagctacaattcggtcgtcgggattaagccgacggtggggctaaccagc
cgcgccggcgtcatcatcatttcgcctaggatggacaccgttgggccaatttgtaggaca
gtttcagatgctgtgcatgttttggaagcaattgttggatatgacccgcgagacgcagag
gcaactcgtatggcgttgcaatatatcccagaagatggttataggcaattcttgaatata
gatgggttaagaggcaagaggttgggaatccttaggaaagatttctttcggtttccctcg
ggctctgtccaacaaaaggtcttcgatgagcatttcaacactataagtaagatgggtgcc
atattggtggacaatctcgagataccaaacatgaacatcatcaacgatgcagtacaaagc
ggtgaacgtgctcttatgctagccgaattcaagttgtccctcaactcatacttgtctgaa
ctggccagttcacctgtaagatcattatcggacataattgatttcaacaacaagcatccg
gtagaggaaaggatggctgaatttggtcagagttaccttctgcaatctgaagcaacagat
ggcactggtccaactgagaagaaggccattgcgaaactgaacgaactttgcgaaagtggc
ctcgagaaaataatgcgagttaatcaactggatgcaattgtttcaccaggtgcatctgct
catagcctgcttgcaatcggcggctatcctgcaatcacagttccagctgggtatgcatcg
aatggtgttccttttgccatctgctttggaggtttgaaaggatcggagccaaggcttatt
gagatagcctattcgtttgaacaggcgacaaaagtgaggagacctccaactttgcagcat
tctatcatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271133
Entry
9271133           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    9271133
   00360 Phenylalanine metabolism
    9271133
   00380 Tryptophan metabolism
    9271133
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     9271133
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-GeneID: 9271133
NCBI-ProteinID: XP_015634579
LinkDB
Position
4:5669063..5675651
AA seq 514 aa
MSRRRLQLLLLAAVVLVHAAADGCRVFQIEEATVDDIQLGFNNGSLTSRQLVFFYLDRIA
RLNPLLHAVIEVNPDALAQAARGVAXSSSSSGSCCGGLHGVPVLLKDSIATRDRLNTTAG
SLALLGSVVRRDAGVVRRLRRAGAVVLGKANLDEWANFRTIQGTGGWSARGGQSRNPYVL
SAAPCGSSTGSAIAAAANMAAVTLGTETDGSILCPSSLNSVVGIKPTVGLTSRAGVVPIS
PRQDTIGPICRTVTDAVHVLDAIVGYDSRDAKATRAASKYIPPGGYRQFLKPDGLKGKRI
GIPNGFFNFPNGTVQQIVYQQLLDTVRKQGAVVIENLDIANLAVIQDVLNNGEQIVLAAE
FKSSLNTYLSDLSYSPVRSLADIIAFNNAHPIEERLKNFGQLIFLVAENTTGIGALEGAV
IRQLNELSADGLEKLMQDEQLDAIITPNDLVSTVLAIGGMPAITVPAGYGKMGVPFGICF
GGLKGYEPRLIEMAYAFEQATKVRKAPKFLHGTF
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgtctcgccgccgtctgcagctgctgcttctcgccgccgtcgtgctcgtccacgccgcc
gccgacggttgccgagtgttccagatcgaggaggccaccgtcgacgacatccagctcggc
ttcaacaacggcagcctcacctccaggcagctcgtgttcttctacctcgaccgcatcgcc
cgcctcaacccgctcctccacgccgtcatcgaggtcaaccccgacgcgctcgcgcaggcg
gcgcgcggcgtcgccnngtcgtcgtcgtcgtcgggcagctgctgcggcgggctccacggc
gtccccgtgctcctcaaggacagcatcgcgacgcgcgaccggctcaacacgacggccggg
tcgctggcgctgctgggctccgtcgtcaggcgggacgccggcgtggtgcggcggctccgg
cgagccggcgcggtggtgctcggcaaggccaacctcgacgagtgggccaacttccgcacc
atccaaggcaccggtggctggagcgctcgcggtggccaaagccggaatccatatgttcta
tcagctgctccatgcggttcaagcacaggatcagccattgcagctgcagcgaacatggcg
gccgtgacactagggaccgaaaccgatggatccatactctgcccatcgtcgttgaattca
gtggttgggatcaaaccaacggttggattgacaagcagggctggtgttgttcctatctcc
cctaggcaggacactatcgggccaatttgtcggacagtaacagatgccgtccacgtgctg
gatgcgattgttggctacgacagccgtgacgcaaaagccacacgggcagcatcaaagtac
atcccaccgggtggatataggcagtttttgaagcctgatggattaaaaggcaagagaata
ggcatcccaaatggatttttcaacttcccaaatgggacagtgcaacagattgtttaccag
caacttctcgacacagtgaggaaacaaggagcggttgtgattgagaacctagacatagca
aacttggctgttatacaagatgtccttaacaatggggaacagattgtgttagcagcagag
ttcaagtcaagccttaacacttatctgtcagacttatcctactccccagttcgttcactt
gcagatataattgctttcaacaacgcacatccgattgaggagaggctaaagaattttggg
cagctcatcttcctggtagctgagaatactactggcatcggtgcactcgagggagctgtg
atccgtcaactaaacgagctttcagctgacggactggagaagctgatgcaggatgagcag
cttgatgcaattatcactcccaatgacctagtttccactgttctcgccattggcggcatg
ccggcaatcaccgtaccagctggatacggtaagatgggagtccccttcggaatttgcttt
ggtggattgaagggctatgagccgaggctaattgagatggcttatgcatttgagcaagct
accaaggtcagaaaggcccctaagttcttgcacggaacattttag

DBGET integrated database retrieval system