KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335047
Entry
4335047           CDS       T01015                                 
Name
(RefSeq) mitochondrial inner membrane protease subunit 2
  KO
K09648  mitochondrial inner membrane protease subunit 2 [EC:3.4.21.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4335047
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4335047
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4335047
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     4335047
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   4335047
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    4335047
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24
Other DBs
NCBI-GeneID: 4335047
NCBI-ProteinID: XP_015636263
UniProt: Q7XS59 B9FDM2
LinkDB
Position
4:4452668..4457656
AA seq 164 aa
MAGPWPLLRSFLRNCVAGTLVVVTVNDRYASVITVRGTSMNPTLESQQGDRALVSRLCLD
ARYGLSRGDVVVFRSPTEHRSLLVKRLIALPGDWIQVPAAQEIRQIPVGHCWVEGDNPDV
SWDSRSYGPIPLGLMQGRVTHIVWPPNRIGPVERKMPEGRVMQR
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcagggccatggcccctcctccggtcgttcctgaggaactgcgtcgccggaaccctc
gtcgtcgtcaccgtcaacgaccggtacgcctccgtcatcaccgtgcgtggcacctccatg
aaccccaccttggagtcccaacaaggtgaccgcgcgctggtgagccggctctgcctcgac
gcccgctacggattgtcccgcggcgacgtcgtcgtcttccggtcgccgacggagcaccgg
agcttgttggtgaagaggttgatcgcgttgcccggcgactggatccaggtgccggcggct
caggagatccggcagatacccgtggggcactgctgggtggaaggggataatcctgacgtc
agctgggactcgcgaagctatggccctattcctctcggtctgatgcaggggagggtcaca
cacatagtctggccaccaaatagaattggcccagttgagagaaagatgccagaaggaaga
gtaatgcagcgatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271486
Entry
9271486           CDS       T01015                                 
Name
(RefSeq) mitochondrial inner membrane protease subunit 2
  KO
K09648  mitochondrial inner membrane protease subunit 2 [EC:3.4.21.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    9271486
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    9271486
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    9271486
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     9271486
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   9271486
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    9271486
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24
Other DBs
NCBI-GeneID: 9271486
NCBI-ProteinID: XP_015632301
LinkDB
Position
3:2682323..2685478
AA seq 166 aa
MGTRNHLWLAAKRTLTWYLVGFTISDRYATVVSVTGDSMHPTFTAASSSLRGAVVLAERS
CLQKYQFSHGDVVLFKCPSDHRELFVKRLIALPGEWMQLPGTPDIIKIPEGHCWVEGDNA
ACSWDSRSFGPIPLGLIKGRVAHVIWPPSKIGRVDTKMPENRISPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atgggaacccgaaaccatctttggttagccgccaagaggactttgacatggtatttagtc
ggtttcaccatttccgatcgatatgcaaccgtagtatcagtgacgggcgattcgatgcat
cccacgtttacagcggccagtagctccttgagaggtgctgtagtgctagccgaaaggagc
tgcctccaaaagtaccagttctcccatggtgatgttgttttgttcaagtgccccagtgat
catagggagttgtttgtcaagagattaattgccctgcctggggagtggatgcagctccct
ggcacccctgatataattaagatcccagaagggcactgctgggttgaaggtgataatgct
gcctgcagctgggattctaggtcatttggcccaatccctttaggtctaattaaagggagg
gtggcccacgtcatctggccaccgtcaaagattggacgagttgatacaaaaatgcctgaa
aatagaatttcacccctttga

DBGET integrated database retrieval system