KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335317
Entry
4335317           CDS       T01015                                 
Name
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00261  Monobactam biosynthesis
osa00300  Lysine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    4335317
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    4335317
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     4335317
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-GeneID: 4335317
NCBI-ProteinID: XP_015633476
UniProt: Q0JEK1 A0A0P0W8M0
LinkDB
Position
4:10061709..10065135
AA seq 380 aa
MASLLIASTGGAHRLAWKDAAALGPAPRLARPWPAAVAAPAPLLRISRGKFALQAITLDD
YLPMRSTEVKNRTSTADITSLRVITAVKTPYLPDGRFDLEAYDSLINMQIDGGAEGVIVG
GTTGEGHLMSWDEHIMLIGHTVNCFGAKVKVVGNTGSNSTREAIHATEQGFAVGMHAALH
INPYYGKTSIEGLISHFEAVLPMGPTIIYNVPSRTGQDIPPAVIEAVSSFTNLAGVKECV
GHERVKCYTDKGITIWSGNDDECHDSRWKYGATGVISVASNLIPGLMHDLMYEGENKTLN
EKLFPLMKWLFCQPNPIALNTALAQLGVVRPVFRLPYVPLPLEKRVEFVRIVESIGRENF
VGENEARVLDDDDFVLVSRY
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcgtcgctgctgatcgccagcacggggggcgcccaccgcctcgcgtggaaggacgcc
gccgccctgggacccgctccgcggctggcgcgaccttggcccgccgccgtggctgcaccg
gcgccgctgctcaggattagcagaggaaagtttgcattgcaggccatcacccttgatgat
tatcttccaatgcgaagtactgaagtgaaaaatcggacatcaacagctgatatcactagt
ctcagagtaattacagcggtcaaaaccccatatctgcctgatggaagatttgatcttgaa
gcatatgattcactgataaatatgcagatagatggtggtgctgaaggtgtaatagttgga
ggaacaacaggagagggccaccttatgagctgggatgaacacatcatgcttattggacat
actgttaactgctttggtgctaaagttaaagtggtaggcaacacaggtagtaactcaaca
agagaggctattcatgcaacagagcagggatttgctgtaggtatgcatgcggctctccat
atcaatccttactatgggaagacctctatcgaagggttgatatctcattttgaggctgtc
ctcccaatgggtccaaccattatttacaatgttccatctaggactggccaggatattcct
cctgcagttattgaggctgtttcaagtttcacaaacttggcaggtgtgaaagaatgtgtt
ggacatgagagggttaagtgctacactgacaaaggtataaccatatggagtggtaatgat
gatgaatgccatgattctaggtggaaatatggtgccactggagttatttctgtggctagc
aaccttattcctggtctcatgcacgatctcatgtatgaaggggagaataagacgctaaat
gagaagctctttcccctgatgaaatggttgttttgccagccaaatccaattgctctcaac
actgccctggctcagcttggagtggtaaggcctgttttcagattaccatatgtacctctt
cctcttgaaaagagggtagagtttgtccgaatcgttgaatctattggacgggaaaacttt
gtgggtgagaacgaggcacgggttcttgacgacgatgattttgtgttggtcagtaggtac
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336734
Entry
4336734           CDS       T01015                                 
Name
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase 1, chloroplastic
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00261  Monobactam biosynthesis
osa00300  Lysine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    4336734
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    4336734
Enzymes [BR:osa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     4336734
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-GeneID: 4336734
NCBI-ProteinID: XP_015636892
LinkDB
Position
4:complement(28932065..28933778)
AA seq 317 aa
MRSSEVKNRTSTGDITSLRVITAVKTPYLPDGRFDLEAYDSLINMQIEGGAEGVIVGGTT
GEGHLMSWDEHIMLIGHTVNCFGTKIKVVGNTGSNSTREAIHATEQGFAVGMHAALHINP
YYGKTSVEGLISHFEAVLPMGPTIIYNVPSRTGQDIPPAVIEAVSSFSNMAGVKECVGHE
RVKCYTDKGITIWSGNDDECHDSRWKYGATGVISVASNLIPGLMRKLMYEGENTALNDKL
LPLMKWLFCQPNPIALNTALAQLGVARPVFRLPYVPLPLEKRVEFVRIVESIGRENFVGQ
KEARVLDDDDFVLISRY
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcgaagtagtgaagtgaaaaatcggacatcaacaggtgatatcactagcctcagagta
ataacagcggttaaaaccccttatctgccggatggaagatttgatcttgaagcatatgat
tcgctgataaacatgcagatagaaggtggtgctgaaggtgtaatagtgggaggaacaaca
ggagagggccacctgatgagctgggatgaacacatcatgcttattgggcatacagttaac
tgctttggcactaaaattaaagtggtcggcaacacaggaagtaactcaacaagggaggct
attcacgcaactgagcagggattcgctgtaggtatgcacgcggctctccacatcaatcct
tactacgggaagacctccgtcgaagggttgatctcccattttgaggctgttctcccaatg
ggtccaaccatcatttacaatgtgccatccaggactggccaggatattcctcctgctgtt
attgaggcggtttcaagtttttcaaacatggcaggtgtcaaagaatgtgttggacatgag
agggttaagtgctatactgacaaaggtataaccatatggagtggtaatgatgatgaatgc
catgattctaggtggaaatatggtgccactggagtcatttctgtagccagcaaccttatt
cccggtctcatgcgtaagctcatgtacgaaggggagaatacagcgctcaatgataagcta
cttcctctgatgaaatggttgttttgccagcctaatccgattgcgctcaacaccgccctg
gctcagcttggagtggcaaggcccgttttcagattaccttatgtacctctcccccttgaa
aagagggttgagttcgtccgaattgtcgaatccattggacgggaaaattttgtgggtcag
aaagaagcaagggttcttgatgatgatgattttgtgttgatcagtaggtattaa

DBGET integrated database retrieval system