KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335330
Entry
4335330           CDS       T01015                                 
Name
(RefSeq) transketolase, chloroplastic
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4335330
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4335330
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    4335330
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     4335330
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C KfrA_N XFP_C
Other DBs
NCBI-GeneID: 4335330
NCBI-ProteinID: XP_015633388
UniProt: Q7XWP9 A0A0P0W806
LinkDB
Position
4:11026643..11032668
AA seq 714 aa
MATATQAPTSPAAASGRGSVLPLLRGRPSTRVRLAVGRRPQTALRAQPPGAAEVVEQSVN
TIRFLAVDSVEKAKSGHPGLPMGCAPLGHVLFDEFLRFNPKNPYWFDRDRFILSAGHGCM
LQYALLHLAGYDSVTMDDLKAFRQWGSRTPGHPENFETPGVEVTTGPLGQGFANAVGLAL
AEKHLAARFNKPDLKIVDHHTYVILGDGCQMEGVSNEASSLAGHWGLGKLIAFYDDNHIS
IDGSTGIAFTEDALARYEALGWHTIWVKNGNTGYDDIRAAIKEAKAVKDKPTLIKVTTTI
GYGSPNKANTYSVHGSALGTKEVEATKNNLSWHHEPFHVPDEVKRHWSHHIDEGASLEAE
WNKKIVEYEKKYRQEAAELKSIISGELPSGWDNSLPKYTPENPADATRNLSQQCLNALAK
AIPGFLGGSADLATSNMTLLKMFGDFQKDTPEERNIRFGVREHAMGAISNGIALHSPGLI
PYCATFFVFTDYMRAAIRLSALCGSRVIFVMTHDSIGLGEDGPTHQPVEQLFSLRAMPNI
LMLRPADGNETSGAYKIAVLNRQRPSVLALSRQKLQQLKGTSAEGVAKGGYIISDNSSGN
KPDIILIGTGSELEIVEKAADELRKDGKTVRVVSLVCWELFEEQSEKYKESVFPSEVTSR
ISVEAGVTFGWEKYIGEKGKAIGVDRFGSSAPAGKIYKELGLTVENVIATAKSL
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggcgacggcgacgcaagctcccacctcgcccgccgccgcgtccgggcgtggctccgtt
ctccccctcctccgtggccgcccctccacccgcgtccgcctcgccgttggccggcgaccg
cagaccgccctccgcgcgcagccgccgggggcggcggaggtggtggagcagtcggtgaac
accatccggttcctcgccgtggactccgtggagaaggccaagtccggccacccgggactc
cccatggggtgcgcgccgctgggccacgtcctattcgacgagttcctccggttcaacccc
aagaacccctactggttcgaccgcgaccgcttcatcctctccgccggccatggatgcatg
ctccagtacgcactgcttcacctcgccggatacgacagcgtcacgatggatgatctgaaa
gctttccggcagtggggaagcagaactcctggtcacccagaaaacttcgaaacacctggt
gttgaagtcactactggtcctctggggcagggttttgcaaatgctgttggcctagcgctt
gctgagaaacatctagctgcccgtttcaataagcctgatttgaaaatcgtggatcatcac
acgtatgttatacttggggatggctgccaaatggaaggtgtgtcaaatgaggcatcctcc
cttgctggtcactggggtctcgggaaactaattgccttctacgatgacaatcatatatca
attgatggtagcacaggcattgctttcactgaagatgcacttgcccgatatgaggcacta
ggttggcatactatctgggtgaaaaatggtaacacagggtatgatgacatccgtgctgca
attaaggaagcaaaggcagtcaaagacaagccaactcttatcaaggtgactactactatt
ggttatggatccccaaacaaagcaaacacttatagtgttcatggtagcgctctaggtacc
aaagaagtagaggcaaccaaaaacaatctttcttggcatcatgaacctttccatgttcct
gatgaggtgaaaaggcactggagtcaccatattgatgagggtgcttctctggaagctgaa
tggaataaaaaaattgttgaatatgaaaagaaatatcgccaggaggctgctgagttaaag
agcataatttcaggagaactgccttccgggtgggacaattctcttccaaaatatactcct
gaaaatcctgctgatgctacaaggaacttatctcaacaatgcttgaatgctcttgctaaa
gcaatacctggatttcttggaggtagtgccgatctcgcaacatcaaatatgacattacta
aaaatgtttggtgattttcaaaaagacacacctgaagaaagaaacatccgttttggtgtg
agagagcatgcaatgggtgccatttccaacggcattgcattgcacagtcctggactaata
ccttactgtgcaacattctttgtgtttactgactatatgagagctgccattcgtctttcg
gccttatgtggatcaagggtgatctttgtaatgactcatgattcaattggccttggagaa
gatgggccaacacatcagcctgttgaacagttattcagcctccgcgccatgccaaacata
ctaatgcttcgacctgcagatggaaacgagacttctggagcttacaagattgcagttctt
aataggcaaaggccctctgtccttgccctttctaggcagaagcttcaacagctgaaagga
acatcagcggaaggcgttgccaagggaggatacattatttctgataattcatcaggaaac
aaaccagatatcattctcatcggcactggttctgaacttgagattgtagaaaaagccgca
gatgagctgaggaaagatgggaagactgtacgagtagtttcactggtttgctgggaattg
tttgaggagcagtcggagaaatacaaggagagtgtttttccaagtgaagtaacttctagg
atcagcgtcgaggctggggtcacatttggatgggagaaatatatcggagaaaaaggtaaa
gctattggtgttgaccgttttggttctagtgcgcctgctgggaaaatatacaaggagctt
ggtttgacagtggaaaatgtcattgcaacggccaagtcactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340025
Entry
4340025           CDS       T01015                                 
Name
(RefSeq) transketolase, chloroplastic
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4340025
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4340025
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    4340025
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     4340025
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh
Other DBs
NCBI-GeneID: 4340025
NCBI-ProteinID: XP_015643207
UniProt: Q84ZY2
LinkDB
Position
6:complement(1808985..1812357)
AA seq 743 aa
MAAHSVAAAHATIAARAGAAAPAPAPPERLGFRLSALAGRGLRSPLPPRRGAPSASASRR
RHNNRVRAAAVETLEGQAATGALLEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHIL
YDEVMRYNPKNPYWFNRDRFILSAGHGCMLQYALLHLAGYDAVLEEDLKQFRQWGSKTPG
HPENFETPGVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYTYCILGDGCQM
EGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSARFEALGWHTIWVKNGN
DGYDEIRAAIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGSALGTKEVEATRENLG
WPYEPFFVPEDVKSHWSRHVPQGAAFEADWNAKFAEYEKKYPEDAATLKSIVSGELPAGW
ADALPKYTPESPADATRNLSQQCLNALAKVVPGLLGGSADLASSNMTLLKMFGDFQKDTP
EERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAMRISALCEAGVIYVM
THDSIGLGEDGPTHQPIEHLVSFRAMPNILMLRPADGNETAGAYKIAVLNRKRPSVLALS
RQKLAQLPGTSIEGVEKGGYIVSDNSTGNKPDFIVMSTGSELEIVAKAADELRKEGKTVR
VVSFVCWELFDEQSAEYKESVLPEAVTARVSLEAGSTLGWQKYVGSKGKAIGIDKFGASA
PAGKIYQEYGITAENVIATAKSL
NT seq 2232 nt   +upstreamnt  +downstreamnt
atggccgcgcactccgtcgccgccgcgcacgccaccatcgccgcgcgcgcgggtgccgcc
gcgccagcgcccgcgccgccggagcgcctcgggttccgcctcagcgcgctcgccggccgc
ggcctccgctccccgctcccgcctcgccgcggcgcgccatcggcgtccgcgtcgcgccgc
cgccacaacaaccgcgtgcgcgcggcggcggtcgagacgctcgaggggcaggcggcgacg
ggggcgctgctcgagaagtcggtgaacacgatccggttcctcgccatcgacgccgtcgag
aaggccaactcggggcaccccggcctgcccatggggtgcgcgcccatggggcacatcctc
tacgacgaggtcatgcggtacaaccccaagaacccctactggttcaaccgcgaccgcttc
atcctctccgccggccacggctgcatgctccagtacgccctgctccacctcgccggctac
gacgccgtcttggaggaggacttgaagcaattcaggcaatggggaagcaagactccaggc
catcccgagaacttcgagacgcccggagttgaagttaccactggacctcttggtcagggt
attgcaaatgcagttgggctggcccttgctgagaagcacctggctgctcgtttcaacaag
cccgacagcgagattgttgatcactacacctactgtattttgggagatgggtgccagatg
gagggtatctccaatgaagcttgctcgttggctggccattggggtcttggcaagctgatt
gcattctatgatgacaaccacatttccattgacggagacacagagattgcattcactgag
gatgtgagtgctcgctttgaggctcttgggtggcatacaatctgggttaagaatggaaac
gatggctatgatgagattcgtgccgccattaaggaagcaaaggcggtaactgacaagcca
acactaatcaaggtgaccaccacaatcggttttggatcacccaacaaggccaactcatac
agcgtccacggaagtgctttgggtaccaaagaggttgaagcaaccagagagaaccttgga
tggccctatgagccattctttgtgcctgaggatgtgaagagccactggagccgccatgtg
cctcaaggtgctgcttttgaggctgactggaatgctaagttcgccgagtatgagaagaag
tacccagaagatgcagcgaccttgaagagcattgtctcaggggagttgcctgctggctgg
gctgacgctcttcctaaatacactccagagagccctgcagatgccaccaggaatctgtca
cagcagtgcttaaacgcacttgctaaagttgttcctggtcttcttggaggaagtgctgat
cttgcatcctccaacatgacattgcttaagatgttcggtgacttccagaaggatacgcct
gaggagcgcaatgtccgatttggagtcagggagcatggaatgggcgccatttgcaacggc
attgctctgcacagcccaggactcattccatactgtgctactttctttgttttcactgat
tacatgagagctgccatgaggatctcagccttgtgtgaagccggagttatctatgttatg
acccatgactctattggtcttggagaagatggtccaacccatcagcccattgagcacttg
gtgagcttccgtgcgatgcccaacattctgatgcttcgtcctgctgatggtaacgagact
gctggggcatacaaaatcgcggtcctcaacaggaagaggccatccgtccttgctctctcc
aggcaaaagcttgctcagctgcctggtacctcgattgagggtgttgagaagggtgggtac
atcgtctctgacaactcaactggcaacaagcctgacttcattgtgatgagcactggctct
gaactagagattgtcgccaaggctgctgatgagttgaggaaggaggggaagactgtccgt
gtcgtgtcatttgtttgctgggagcttttcgatgaacagtcggctgagtacaaggagagt
gttctccctgaggctgttactgcaagagtcagccttgaagcagggtctactcttggatgg
cagaagtacgtcggaagcaaaggcaaggctattggcatcgacaaattcggtgcaagtgct
cctgctggaaagatctaccaggagtatggcatcaccgcggagaacgtcatcgcaacagca
aagagcctgtaa

DBGET integrated database retrieval system