KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335637
Entry
4335637           CDS       T01015                                 
Name
(RefSeq) putative ribosome biogenesis GTPase RsgA 1
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4335637
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:osa03009]
    4335637
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     4335637
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-
     4335637
Ribosome biogenesis [BR:osa03009]
 Prokaryotic type
  GTPases
   4335637
SSDB
Motif
Pfam: RsgA_GTPase MMR_HSR1 AAA_16 ABC_tran AAA_29 AAA_23 AAA_22 Adeno_IVa2 AAA_21 Septin SMC_N AAA_18 Roc ATP-synt_ab Guanylate_kin AAA_30 ATPase_2 IIGP AAA_15 AAA_7
Other DBs
NCBI-GeneID: 4335637
NCBI-ProteinID: XP_015634817
UniProt: A0A0P0W9L9
LinkDB
Position
4:18702259..18707747
AA seq 515 aa
MFGKPRLSASLTPRHPHTAHRENSTRNHAKILDPPRNPPRHQKNPPPGVACVRAVRAAPH
PKTPRRAAAKCRSSPPPPPPPPPPATLPHLPLLLPRVLLPRRASSHHGPLHLRLLPAAAA
APLPPPPSSPDELLPDQATGLVAASQANFMRVIVGAAPRGVEGARPGGDLLCVVRALLKK
IRRRVLVGDRVLIGAVDWAGGRGVIEGVFERRAEVADPPVANVDRLVLLFALDQPQPEPA
TLTRFLVDAESTGIPFVLVFNKVELVDDKTISYWRDRMKSWGYDPLFLSVDQKSGLSALE
ETLEGQTTVIVGPSGVGKSSLINALRSNQNISEEDPIHKLVEQNSKWFGEQRVGTVSKKS
GKGKHTTRHVSLLPIAGGGFLADTPGFNQPSLMKVTKKGLAETFPEIRKMLAENEPSKCL
FNDCVHLGERGCVVKGDWERYPYYLQLLDEIKIRESFQLRTFGTKREGDVRYKTGVMGVK
QAEPRLQLKKHRRVSRKKINQSILDDIDDELDEDN
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgtttggtaaaccacggttgtcagccagccttaccccacggcatccgcacaccgcacac
cgcgagaattccacgcgaaatcacgcgaaaatcctcgaccccccgcgaaaccccccgcgt
caccagaaaaatccgccccccggcgtcgcgtgcgtgcgtgcggtgcgcgccgcgcctcac
ccaaaaaccccccgccgcgccgccgcgaaatgccgctcctcccctccccctcccccgcca
ccgccgccgccggccacgctgccccacctccccctcctcctcccgcgcgtcctcctgcca
cgccgcgcttcctcccaccacggccccctccacctgcggctgctccccgcggcggcggcg
gcgcccctccccccgccgccgtcatccccggacgagctgctcccggaccaggcgacgggg
ctggtggcggcgtcgcaggccaacttcatgcgggtgatcgtcggcgccgcgccgcgcggg
gtggagggggcgcgcccgggcggggacctgctgtgcgtggtgcgcgccctcctcaagaag
atccgccgccgcgtcctcgtcggggacagggtgctcatcggggccgtcgactgggccggc
ggccgcggggtgatcgagggcgtcttcgagcgccgcgccgaggtggccgacccgcccgtc
gccaacgtcgaccgcctcgtcctcctcttcgccctcgaccagccccagcccgagcccgct
acgctcaccaggttcctcgtcgacgccgagtccaccgggatacctttcgtgctcgtcttc
aacaaggtcgagcttgtggacgacaagaccatatcatactggagagataggatgaagagt
tggggatacgatccactatttttaagtgttgatcagaaatcaggattatccgctcttgaa
gaaacattggaaggacagacaactgtaattgttggtccaagcggtgttggaaagtccagt
ctgatcaatgctttgagaagcaaccagaacatctcagaagaagatcccatacataaacta
gttgagcagaatagtaaatggtttggtgaacaacgggtcggtaccgtgtcgaagaaaagc
ggcaaaggaaagcacacaacacgtcatgtttcattgcttcctatagctggtggaggtttt
cttgctgatactccaggatttaaccagcctagcctgatgaaagtgaccaagaagggtctt
gcagaaacatttccagagataagaaagatgcttgcagagaatgagccctcaaaatgttta
tttaatgactgtgttcaccttggtgagcgtggatgtgttgtgaaaggtgactgggaaagg
tatccatactatctacagttgcttgatgaaatcaaaatcagagaatcattccagttaaga
acatttggaacaaaaagagagggtgatgtcagatacaaaacaggtgtcatgggtgtaaag
caagcagagcctcgtcttcaactcaaaaagcacagaagggtatcaagaaagaagattaac
cagtcaattcttgatgatattgatgatgagctcgacgaagacaactag

DBGET integrated database retrieval system