KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335708
Entry
4335708           CDS       T01015                                 
Name
(RefSeq) glycine--tRNA ligase, mitochondrial 1
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4335708
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4335708
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4335708
   03029 Mitochondrial biogenesis [BR:osa03029]
    4335708
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     4335708
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   4335708
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4335708
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4335708
SSDB
Motif
Pfam: HGTP_anticodon tRNA-synt_2b
Other DBs
NCBI-GeneID: 4335708
NCBI-ProteinID: XP_015636479
UniProt: Q7XLG5
LinkDB
Position
4:19677037..19682167
AA seq 673 aa
MLLSSASRALAAAKPRSPEPFAAAAAVLLRRQLAAGMAAAPASSASAAGNREAFRVAVTN
TLERRLFYVPSFKIYGGVAGLYDYGPPGCAVKANVLAFWRQHFVLEEGMLEVDCPCVTPE
VVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDNTLSPEKTAEFNHVLAV
LDDLSAEQLGAKIKEYGIVAPDTKNPLSDPYPFNLMFQTSIGPSGLSPGYMRPETAQGIF
VNFKDLYYYNGNKLPFAAAQIGQAFRNEISPRQGLLRVREFTLAEIEHFVDPEDKSHPKF
RDVSDLEFFMFPREQQLTGKSAMKLNIGQAVSEGTVNNETLGYFIGRVYLFLTQLGIDKD
RLRFRQHLPNEMAHYAADCWDAEIECSFGWIECVGIADRSAYDLRAHSDKSGVALEAHEK
FAEPREVEKLVITPSKKELGLAFKGNQRMVLEALEAMSETEALNMKSALESKGEVEFKVC
TLGKDVTIKKSMVSINMEKKKEHQRKFTPSVIEPSFGIGRIIYCLFEHCFYQRPGKAEDE
QLNVFGFPPLVAPIKCTVFPLVKIEKFEVVAKKISKALTAAGISHIIDMTGNTIGKRYAR
TDEIGVPLAITVDNTTSVTVRDRDSKDQIRVEVDEVASVVKEVTDGQSTWADIMWRYPAH
TASAAEEEEASET
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgctcctctcctccgcctcacgcgcactcgccgccgcaaaaccccgctcgcctgaaccc
ttcgccgccgccgccgcggtcttactccgccgccagctcgccgcaggcatggcggccgcg
ccggcgtcgtccgcgtccgcggcggggaaccgcgaggcgttccgcgtggcggtgaccaac
acgctggagcgccgcctcttctacgtcccgtccttcaagatctacggcggcgtcgcgggc
ctctacgactacggccctcccggctgcgccgtcaaggccaacgtcctcgccttctggcgc
cagcatttcgtgttggaggaggggatgcttgaggtggactgcccatgtgtgactcctgaa
gttgtcttgaaggcctctggccatgtcgacaaatttacagatctgatggttaaagatgaa
aagactggcacctgctatcgtgctgatcatttgctcaaggacttctgcaaggataagctt
gagaaggacaatacattgtcaccagagaagacagcagaattcaaccatgttcttgctgtc
ttggatgatctgtctgcagaacagttgggtgctaagatcaaggagtatggcattgttgct
ccagacaccaagaacccgttgtcagacccatacccctttaacctcatgtttcaaacttcc
attggaccatcaggcttgagcccagggtatatgaggccagagacagcacaaggtatcttt
gtaaacttcaaagacttgtattactacaacggcaacaagctaccctttgctgcagcacag
attggtcaggccttcagaaatgagatatctcctcgccaaggacttctgagagtccgagaa
tttactttagcggagattgagcactttgtggacccagaggacaaatcccacccaaagttt
cgtgatgtttctgatctggaattttttatgtttccaagagaacaacaactgacaggaaaa
tcagccatgaaacttaacattggacaggctgtatctgaggggactgttaacaatgagacc
cttggctactttattggaagggtctatctcttcttgacgcagcttggaattgacaaagat
cgtctacggttccgacagcacctgccaaatgaaatggctcattatgctgctgattgctgg
gatgcagagattgaatgctcttttgggtggattgagtgtgttgggattgctgataggtct
gcatatgatctgcgtgctcactcggataaaagtggtgttgcacttgaagcacatgaaaag
tttgcagagcctagagaagtggagaagttagttataaccccgtcaaagaaggaactaggt
cttgcgttcaaagggaatcaaaggatggttcttgaagcattggaggcaatgagcgagact
gaagctttgaatatgaaatcagctttagaatccaaaggggaggttgaatttaaggtgtgt
acacttgggaaagatgtcaccataaagaaaagcatggtttcaattaacatggagaagaaa
aaggaacatcaaaggaaatttactccttctgtcatagagccatcctttggcatagggaga
atcatttactgtctgttcgaacattgcttctatcaaagacctggcaaggcggaggatgag
cagttgaatgtattcggtttcccccctcttgttgctcccatcaagtgcactgtctttcca
cttgtcaagatcgaaaaatttgaagttgttgccaagaaaatttcgaaagcattgacagca
gcagggatttctcacataattgatatgacaggtaacacaatcggtaagcgttatgcaagg
accgatgaaatcggtgtccccctggcaatcacggttgacaacaccacgagtgtgactgtc
cgtgaccgggacagcaaggatcagatccgcgttgaggtcgatgaggtggcctcagtggtg
aaggaagtgacggacgggcagagcacctgggcagacatcatgtggaggtacccggcacat
actgcctcggccgctgaagaggaggaagcatcagaaacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339847
Entry
4339847           CDS       T01015                                 
Name
(RefSeq) glycine--tRNA ligase, chloroplastic/mitochondrial 2 isoform X1
  KO
K14164  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4339847
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4339847
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     4339847
Transfer RNA biogenesis [BR:osa03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4339847
SSDB
Motif
Pfam: tRNA_synt_2f tRNA-synt_2e DALR_1
Other DBs
NCBI-GeneID: 4339847
NCBI-ProteinID: XP_015643028
UniProt: Q0DFB6
LinkDB
Position
6:233781..244629
AA seq 1068 aa
MAGLAPPPLLLLPLSSSLSPAAASHHPTSPPSRTRRRRRLLSAVASADGDAPSPVSVSAS
AATKGPSSSSVLTFQQAIQRLQDYWASVGCAVMQCSNTEVGAGTMNPLTFLRVLGPEPWN
VAYVEPSIRPDDSRYGDNPNRLQRHTQFQVILKPDPGNSQDLFLHSLSALGINVREHDIR
FVEDNWESPVLGAWGLGWEVWMDGMEITQFTYFQQSGSLPLLPVSVEITYGLERILMSLQ
GVDHFKNIQYTKGITYGELFLENEKEMSAYYLEHANVDNIQKHFDDFEEEARSLLSLWLP
IPAYDHVLKASHAFNILDSRGFVGVTERARYFGRMRSLARQCAQLWVKTRENLGYPLGTY
QESNLIYPHVSEKPSRKGVVGQPRAFVLEIGTEELPPHDVIEATKQLEKSLIQILEKRRL
SHGKVRSYGTPRRLAVVVENLNMKQMEEEIELRGPPVAKAFDQEGRPTKAAEGFCRKNNV
LIDSLYRRTDGKTEYIYARVKESARFADEVLTEDLPTIISGISFPKSMRWNSNIVFSRPI
RWIFALHGDLIVPFCFAGISSGNQSCGLRNSSLANFKVEAAELYLHTLEKAGILIDMQER
KQRILHDSSILAEGVGGDIIAPDSLVQEVINLVEAPMPIIGRYDVSFLALPKDVLITVMQ
KHQKYFPVTSKTMGNLLPCFITVANGAIKEEVVRKGNEAVLRARYEDAKFFYKMDTQKKL
SEFRDQLSSILFHERLGTMLDKMKRVENTVAEVALLLGINEKMIPAIKDAAALAMSDLAT
NIVTEFTSLAGIMARHYALRDGLSEQIAEALFEITLPRFSGDVFPKTDPGIVLAVTDRLD
SLVGLFGAGCQPSSTNDPFGLRRISYGLVQILVENKKNFDLTKALTLVAEEQPITIDSGV
IDEVVQFVTRRLEQLLVDEGINCEIVRSVLIERANCPYLASQTAIEMEAFSRTEDFPKIV
EAYSRPARIIRGKEIGSALEVDASVFEKDEERALWSAYLEVADKIHPGVDIKAFADASLE
LLQPLEDFFTNVFVMAEDERVRNNRLALLTKVASLPKGIADLSVLPGF
NT seq 3207 nt   +upstreamnt  +downstreamnt
atggcgggtttggctccccctcccctcctcctcctccccctctcctcctcactctctcct
gccgccgcctcccaccacccaacctcccccccttctcgcacacgccgacgacgccgcctg
ctatccgccgtggcgtctgccgacggtgatgctccctccccagtctctgtctccgcctcc
gccgccaccaaggggccttcctcctcctccgtgctcaccttccagcaggccatccagcgc
ctccaggactactgggcctcagtggggtgtgccgtcatgcagtgcagcaatacagaggtt
ggagcagggaccatgaatcccttgacattcctcagggttttaggccccgagccatggaac
gttgcttatgtggagccaagtataagacccgacgacagccgctatggggacaatcctaat
aggcttcagcgtcatactcaatttcaggtaattttgaagcctgaccctggaaattcacaa
gacctctttctgcacagcctttcagcactaggtatcaatgtccgtgaacatgacatccgt
tttgttgaagacaactgggagagtccagttcttggtgcgtggggattaggctgggaggtt
tggatggatggcatggaaataacacagttcacatattttcagcagtcaggaagccttcca
ttgctgcctgtttctgttgagataacatatggacttgaacgcatcctcatgtctcttcag
ggtgtagatcatttcaagaatatacaatacactaaaggaattacatatggagaactattc
cttgagaatgagaaagagatgagtgcatattatttggagcatgcaaatgttgataacatt
caaaagcattttgatgattttgaagaagaggctcgctctttattatcactttggcttcct
attcctgcgtacgatcatgttctgaaggcctctcatgcttttaatattttagattctaga
ggctttgttggtgtaaccgagcgtgcaagatattttggtcgcatgcggagtcttgctcgc
cagtgtgctcagctttgggtgaaaacaagagagaacctcggttatcctttgggcacttat
caagagtctaatcttatctatcctcatgtctctgaaaagcctagtagaaagggagttgtc
ggacagccacgagcatttgttcttgaaataggaacagaagagttgccacctcatgatgtg
atagaagcaaccaaacagctggagaaatctttaattcaaatattggagaaacgaagactg
agccatgggaaagtacgctcttatgggacaccaaggagattagcggttgttgttgaaaat
cttaatatgaagcaaatggaggaagagattgaactacgtggtccacctgttgcaaaggca
tttgaccaagaaggaagacccactaaggctgctgaaggattttgtcgaaagaataatgtc
ctgatagatagtctatatagaagaactgatggtaaaacagaatatatctacgctcgggtc
aaagagtctgcacgttttgctgatgaggtactaactgaagatctaccgactattatatct
ggtatttcatttcccaagtctatgcgctggaactccaatattgtgtttagcaggccaata
cgctggatctttgcccttcatggggatctcattgtgccattttgctttgctggcatatca
agtgggaatcagtcgtgtggccttcgtaactcctccttggctaactttaaggtggaagct
gcagaattatatttacacaccctggagaaagctgggatcctgattgatatgcaggagcgc
aaacaacgaatcttgcatgactctagtatattggctgagggtgttggcggtgatatcatt
gcacctgatagcttggtgcaggaggttatcaatcttgtggaggcgccgatgcccattatt
ggtcgatacgatgtttccttcttagcacttccaaaggatgtattaataacggttatgcag
aaacaccagaaatatttccctgtaacctccaagaccatgggcaatctgctaccatgtttc
ataactgttgccaatggtgccattaaggaagaagtagtccgcaaagggaatgaagctgta
ctcagggcacggtatgaggatgctaaattcttttataagatggatacgcagaagaaactt
tctgaattccgagatcagctcagcagcattctctttcatgaaagacttggtaccatgctt
gacaaaatgaaacgtgttgagaacactgttgcagaagtggccctccttctcggaattaat
gagaaaatgatcccagcaatcaaagatgcagctgcattggctatgtcagatcttgccact
aatattgttactgaatttacttcacttgctggaattatggcacggcattatgctttgaga
gatggcctttcagaacagattgcagaagccctatttgagataacacttccaaggttctct
ggtgatgtgttcccaaaaacagatcctggcatagtccttgcagtcactgacagattggat
agtctagtgggtctgtttggagctggatgccaaccaagttctacaaatgatccatttggg
ctaaggagaatttcctatggattggttcaaatattggttgagaacaagaagaactttgac
ctcacgaaggccttgaccttagtggcagaggagcagccaataacaatagatagtggtgtt
atagatgaggtagtacaatttgtcacgcggagattggagcaacttttggtggatgaagga
attaattgcgagatagtccgttcagtgcttatagagcgtgcaaactgcccttatctagca
tcacaaacagcaattgaaatggaagcattttcaagaactgaagatttcccaaaaattgtc
gaagcgtactcaaggcccgcgagaataatacgtggaaaagaaattgggtctgctttagag
gttgatgcaagtgtatttgagaaagacgaagaaagagctttgtggagtgcctacttggag
gttgcggataagattcatcctggtgttgacataaaagcctttgcggacgcttctctggaa
ctgctgcaacccctagaagatttctttacaaatgtttttgtcatggcggaagacgagaga
gttcgtaacaatcggcttgcactgctaacgaaggttgcgagtctgccaaagggaattgcc
gacctgtcagttttaccagggttttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346171
Entry
4346171           CDS       T01015                                 
Name
(RefSeq) glycine--tRNA ligase, mitochondrial 1
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4346171
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4346171
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4346171
   03029 Mitochondrial biogenesis [BR:osa03029]
    4346171
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     4346171
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   4346171
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4346171
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4346171
SSDB
Motif
Pfam: HGTP_anticodon tRNA-synt_2b WHEP-TRS
Other DBs
NCBI-GeneID: 4346171
NCBI-ProteinID: XP_015650377
LinkDB
Position
8:26900341..26904610
AA seq 737 aa
MRFRPRIFSPSLFGPSKPRTPTLAASPPAAAAARRRIVSMASSTTTSEDALRRALAERQA
AVDAQAEAVRALKAAGAAAAKAEVDAAVEALKALKVEAGAAARRLQAAVGASGGGGGAAR
EEMRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCAVKANVLAFWRQHFVLEENMLE
VDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDHCKEKLEKDLTLSPEKA
AELKHVLAVLDDLSADELGAKIKEYGIVAPDTKNPLSDPYPFNLMFQTSIGPTGLNVGYM
RPETAQGIFVNFKDLYYYNGQKLPFAAAQIGQAFRNEISPRQGLLRVREFTLAEIEHFVD
PEDKSHPKFVDVADLEFLMFPRELQLSGESAKLVKLGEAVSKGTVNNETLGYFIGRVYLF
LTRLGIDKNRLRFRQHLPNEMAHYAADCWDAEIECSYGWIECVGIADRSAYDLRAHSDKS
GVPLVAHEKFSKPREVEKLVIVPSKKDLGLAFKGNQKMVVEALEAMSEKEAMDMKAALES
KGETNFQVCTLGKDVVITKKMVSISMEKKLEHQRVFTPSVIEPSFGIGRIIYCLFEHSFY
TRPSKSEEEQLNVFRFPPIVAPIKCTVFPLVKNQEFDDAAKVIDKALTTAGISHIIDTTA
ISIGRRYARTDEIGVPFAVTVDSATSVTIRERDSKEQIRVGIDEVASVVKQLTDGQSTWA
DVSFKYPSHIGPQGDQE
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgcgattccgcccccggattttctccccttcgcttttcggcccctctaaacccagaacc
ccaaccctagccgcctccccacccgccgccgccgccgctcgccgccggatcgtctcgatg
gcctcctcgacgacgacgtcggaggacgcgctgcgccgggcgctggcggagaggcaggcg
gccgtggacgcgcaggcggaggcggtgcgggcgctcaaggcggcgggggcagctgcggcc
aaggccgaggtggatgccgcggtcgaggcgctcaaggcgctcaaggtggaggccggcgcc
gccgcgcggaggctgcaggcggccgtcggggcttccggcggcggaggcggggccgcgcgg
gaggagatgcggcaggcggtggtgaacacgctggagaggaagctgttctacatcccttcc
ttcaagatctaccgcggcgtcgccgggctgtacgactacggcccgccgggatgcgccgtc
aaggccaacgtgctcgccttctggaggcagcacttcgttttggaggagaacatgttggag
gttgactgcccctgtgtgacgcctgaggttgtgttgaaggcatcggggcatgtcgagaag
tttactgacctcatggttaaggatgagaagacaggcacatgctaccgtgctgaccacctg
ttgaaagatcactgcaaggagaagcttgagaaggatctcaccttgtccccggagaaggca
gctgaattgaagcatgttcttgctgtcctggatgacctttcagcagatgaacttggcgca
aagattaaggaatatgggattgttgcccctgatactaagaacccgctctctgatccctac
ccgttcaatcttatgttccagacatccatcggccctaccggtcttaatgttgggtatatg
agaccagaaacagcacagggtatttttgtcaacttcaaggacttgtactattacaacggg
caaaagctccctttcgcagcagctcaaatcgggcaagcattccgtaatgagatttctcca
cgacaaggtcttctacgtgtgcgtgaattcacattagccgagattgagcactttgtggat
cctgaggataaatctcacccaaaatttgttgatgttgctgatttggagtttttgatgttt
ccaagagagctgcaactttcaggggagtcagccaagttagtgaagcttggggaagcagtt
tcaaagggaactgttaataatgagacacttggttacttcattgggagggtctatcttttc
ctaacacgtttgggtattgataaaaaccggctacgcttcaggcagcatctacctaatgag
atggcccattatgctgctgactgttgggatgcagagattgagtgctcttacggatggata
gaatgtgtgggcattgctgacagatctgcgtatgatttgcgagctcattctgacaaaagt
ggtgttccacttgttgctcatgaaaaattctcaaagcctagagaggttgagaaacttgtt
atagtgccctcaaagaaagacctggggcttgcttttaaggggaaccaaaagatggtggtt
gaagcattggaggctatgagtgagaaagaagcaatggacatgaaagctgctcttgaatct
aagggagaaacaaatttccaagtgtgtactcttggaaaggatgtggtaataaccaagaaa
atggtatcgatcagtatggaaaagaagttggaacaccaacgagtcttcaccccatcagtc
attgagccttcatttggcattgggaggataatctactgtctatttgagcattccttctac
acaagacctagcaaatcagaagaggaacaactgaatgtcttccggttccctcctattgtt
gctcctatcaaatgcactgtgttccccctggtgaagaatcaggagtttgacgacgctgcg
aaagttattgataaagcattaacaacagcaggcatctcgcatattattgacactactgcc
atttctattgggaggaggtatgcaaggacagatgagatcggtgttccattcgcggtaaca
gttgactctgcgacaagcgtgacaatccgggagagggacagcaaggagcagatccgagtt
ggcatcgatgaggtggcatcagtggtgaaacagctgacagatgggcaaagcacctgggcc
gatgtttcatttaagtatcccagccatattggtccccagggtgatcaggagtga

DBGET integrated database retrieval system