KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336028
Entry
4336028           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein CP24, chloroplastic
  KO
K08917  light-harvesting complex II chlorophyll a/b binding protein 6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4336028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4336028
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCII
    4336028
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4336028
NCBI-ProteinID: XP_015636811
UniProt: Q7XV11 Q0JCQ4
LinkDB
Position
4:complement(22835910..22837589)
AA seq 252 aa
MALASTSATASAAVLKTPFLGAKRALANAVGVAGAKPAPRRALVVSAKKSWIPAFKSDAE
FINPPWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGVP
WFEAGAQPEAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQAVEWATPWSRTAENFS
NATGEQGYPGGKFFDPLGLGGETRDGVYIPDTDKLDRLKLAEIKHARLAMLAMLIFYFEA
GQGKTPLGALGL
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcgctcgcctccacctccgccaccgcgtccgcggccgtgctcaagacgcccttcctc
ggggcgaagcgcgcgctcgccaatgccgtcggcgtcgcgggcgccaagcccgcgccgcgc
cgcgcgctcgtcgtgtcggccaagaagtcgtggatcccggccttcaagagcgacgccgag
ttcatcaacccgccgtggctcgatggctcgctccccggtgacttcggcttcgacccgctg
gggctgggcaaggacccggcgttcctcaagtggtacagggaggcggagctgatccacggg
cggtgggcgatggcggcggtgctggggatcttcgtcgggcaggcgtggagcggcgtgccg
tggttcgaggccggcgcgcagccggaggccatcgcgcccttctccttcggctccctcctc
gggacgcagctgctgctcatgggctgggtagagtccaagcggtgggtcgacttcttcaac
ccggactcgcaggcggtggagtgggccacgccgtggtcgcgcaccgccgagaacttctcc
aacgccaccggcgagcagggctaccccggcggcaagttcttcgacccgctcggcctcggc
ggcgagaccagggacggcgtctacatcccggacaccgacaagctcgaccggctcaagctc
gccgagatcaagcacgcccgcctcgccatgctcgccatgctcatcttctacttcgaggcc
ggccagggcaagacgccgctcggcgccctcggcctatga

DBGET integrated database retrieval system