KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336081
Entry
4336081           CDS       T01015                                 
Name
(RefSeq) betaine aldehyde dehydrogenase 1
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
Module
osa_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4336081
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     4336081
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-GeneID: 4336081
NCBI-ProteinID: XP_015637091
UniProt: O24174
LinkDB
Position
4:complement(23171479..23176326)
AA seq 505 aa
MAAPSAIPRRGLFIGGGWREPSLGRRLPVVNPATEATIGDIPAATAEDVELAVSAARDAF
GRDGGRHWSRAPGAVRAKYLKAIAAKIKDKKSYLALLETLDSGKPLDEAAGDMEDVAACF
EYYADLAEALDGKQRAPISLPMENFESYVLKEPIGVVGLITPWNYPLLMATWKVAPALAA
GCTAVLKPSELASLTCLELGGICAEIGLPPGVLNIITGLGTEAGAPLASHPHVDKIAFTG
STETGKRIMITASQMVKPVSLELGGKSPLIVFDDVDIDKAVEWAMFGCFANAGQVCSATS
RLLLHEKIAKRFLDRLVAWAKSIKISDPLEEGCRLGSVVSEGQYQKIMKFISTARCEGAT
ILYGGARPQHLKRGFFIEPTIITNVSTSMQIWREEVFGPVICVKEFRTEREAVELANDTH
YGLAGAVISNDLERCERISKAIQSGIVWINCSQPCFVQAPWGGNKRSGFGRELGQWGLDN
YLSVKQVTKYCSDEPYGWYRPPSKL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggccgcgccgtcggcgatcccccgccgcggcctgttcatcggcggcgggtggcgggag
ccgtccctcggccgccgcctccccgtcgtcaacccggccacggaggcaaccatcggtgac
atcccggcggccacggcggaggacgtcgagctcgcggtgtcggcggcgagggatgcgttc
ggccgcgacggtgggagacactggtcgcgcgcgcctggggccgtgcgggccaagtacctc
aaggcgatcgccgctaagattaaagataagaaatcttatctagctttgttggagactctt
gattctgggaagcctctggatgaagcagctggggacatggaggatgtcgctgcatgcttt
gagtattatgctgatctggcagaagctttagatgggaaacaacgggcaccaatctctcta
cccatggaaaattttgagtcctatgtactcaaagaacccattggggttgttggacttatc
actccctggaattatcctctgctgatggctacttggaaggttgcacctgccctggctgct
gggtgtacagctgtattaaagccatctgagcttgcttccctgacatgtttagagcttggt
ggaatatgtgcagaaattggattacctccaggagtcttgaacataattactggtctgggc
actgaagctggtgctccattagcttcacatccccatgtggataagattgcttttactgga
agcacagaaactggtaagaggataatgattactgcttcccaaatggtcaagcctgtttcg
ttagagcttggtggcaaaagtcctcttattgtctttgatgatgttgatattgataaagct
gttgagtgggccatgtttgggtgttttgcgaacgctggtcaagtctgcagtgctacttct
cgtctacttttgcatgagaaaattgcaaagcgattcttggataggttggttgcatgggca
aagagtatcaaaatctcagatccactagaagaaggttgcaggctggggtcagtcgttagt
gaagggcagtatcaaaaaataatgaagttcatctcaacagcaagatgtgaaggtgccaca
attctatatgggggtgcccgaccacaacacctcaaaagggggttctttattgagcctact
attataacaaatgttagcacatcaatgcaaatttggcgagaggaagtctttggaccggtc
atctgcgttaaagaatttaggacagagcgtgaagcagtagaacttgcaaatgatactcac
tatggtctagctggcgctgtgatttccaatgatctagagaggtgcgagcgcatttcaaag
gctatccagtcaggtatcgtttggataaattgctcgcaaccatgctttgttcaagctcca
tggggagggaacaagcggagtggttttggccgggagctaggacagtggggcctcgataac
tacttgagcgtgaagcaagtcaccaagtactgctcagatgaaccatacggatggtaccgg
cctccatccaagctgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345606
Entry
4345606           CDS       T01015                                 
Name
(RefSeq) betaine aldehyde dehydrogenase 2
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
Module
osa_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4345606
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     4345606
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 4345606
NCBI-ProteinID: XP_015650889
UniProt: Q84LK3
LinkDB
Position
8:20379779..20386042
AA seq 503 aa
MATAIPQRQLFVAGEWRAPALGRRLPVVNPATESPIGEIPAGTAEDVDAAVAAAREALKR
NRGRDWARAPGAVRAKYLRAIAAKIIERKSELARLETLDCGKPLDEAAWDMDDVAGCFEY
FADLAESLDKRQNAPVSLPMENFKCYLRKEPIGVVGLITPWNYPLLMATWKVAPALAAGC
TAVLKPSELASVTCLELADVCKEVGLPSGVLNIVTGLGSEAGAPLSSHPGVDKVAFTGSY
ETGKKIMASAAPMVKPVSLELGGKSPIVVFDDVDVEKAVEWTLFGCFWTNGQICSATSRL
ILHKKIAKEFQERMVAWAKNIKVSDPLEEGCRLGPVVSEGQYEKIKQFVSTAKSQGATIL
TGGVRPKHLEKGFYIEPTIITDVDTSMQIWREEVFGPVLCVKEFSTEEEAIELANDTHYG
LAGAVLSGDRERCQRLTEEIDAGIIWVNCSQPCFCQAPWGGNKRSGFGRELGEGGIDNYL
SVKQVTEYASDEPWGWYKSPSKL
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggccacggcgatcccgcagcggcagctcttcgtcgccggcgagtggcgcgcccccgcg
ctcggccgccgcctccccgtcgtcaaccccgccaccgagtcccccatcggcgagatcccg
gcgggcacggcggaggacgtggacgcggcggtggcggcggcgcgggaggcgctgaagagg
aaccggggccgcgactgggcgcgcgcgccgggcgccgtccgggccaagtacctccgcgca
atcgcggccaagataatcgagaggaaatctgagctggctagactagagacgcttgattgt
gggaagcctcttgatgaagcagcatgggacatggacgatgttgctggatgctttgagtac
tttgcagatcttgcagaatccttggacaaaaggcaaaatgcacctgtctctcttccaatg
gaaaactttaaatgctatcttcggaaagagcctatcggtgtagttgggttgatcacacct
tggaactatcctctcctgatggcaacatggaaggtagctcctgccctggctgctggctgt
acagctgtactaaaaccatctgaattggcttccgtgacttgtttggagcttgctgatgtg
tgtaaagaggttggtcttccttcaggtgtgctaaacatagtgactggattaggttctgaa
gccggtgctcctttgtcatcacaccctggtgtagacaaggttgcatttactgggagttat
gaaactggtaaaaagattatggcttcagctgctcctatggttaagcctgtttcactggaa
cttggtggaaaaagtcctatagtggtgtttgatgatgttgatgttgaaaaagctgttgag
tggactctctttggttgcttttggaccaatggccagatttgcagtgcaacatcgcgtctt
attcttcataaaaaaatcgctaaagaatttcaagaaaggatggttgcatgggccaaaaat
attaaggtgtcagatccacttgaagagggttgcaggcttgggcccgttgttagtgaagga
cagtatgagaagattaagcaatttgtatctaccgccaaaagccaaggtgctaccattctg
actggtggggttagacccaagcatctggagaaaggtttctatattgaacccacaatcatt
actgatgtcgatacatcaatgcaaatttggagggaagaagtttttggtccagtgctctgt
gtgaaagaatttagcactgaagaagaagccattgaattggccaacgatactcattatggt
ctggctggtgctgtgctttccggtgaccgcgagcgatgccagagattaactgaggagatc
gatgccggaattatctgggtgaactgctcgcaaccctgcttctgccaagctccatggggc
gggaacaagcgcagcggctttggacgcgagctcggagaagggggcattgacaactaccta
agcgtcaagcaagtgacggagtacgcctccgatgagccgtggggatggtacaaatcccct
tccaagctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347172
Entry
4347172           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 7 member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00260  Glycine, serine and threonine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4347172
   00053 Ascorbate and aldarate metabolism
    4347172
   00620 Pyruvate metabolism
    4347172
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4347172
   00561 Glycerolipid metabolism
    4347172
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4347172
   00280 Valine, leucine and isoleucine degradation
    4347172
   00310 Lysine degradation
    4347172
   00330 Arginine and proline metabolism
    4347172
   00340 Histidine metabolism
    4347172
   00380 Tryptophan metabolism
    4347172
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4347172
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     4347172
    1.2.1.8  betaine-aldehyde dehydrogenase
     4347172
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     4347172
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 4347172
NCBI-ProteinID: XP_015611835
UniProt: A0A0P0XM96 Q69P84
LinkDB
Position
9:complement(16330101..16338641)
AA seq 509 aa
MGSFARKEHQFLAELGLAPRNPGSFACGAWGGSGPVVTSTNPTNNQVIAEVVEASAREYE
EGMRACYDAAKTWMAIPAPKRGEIVRQIGDALRAKLHHLGRLVSLEMGKILPEGIGEVQE
IIDMCDYAVGLSRQLNGSIIPSERPNHMMMEVWNPLGVVGVITAFNFPCAVLGWNACIAL
VCGNCVVWKGAPTTPLITIAMTKIVASVLERNNLPGSIFTAFCGGADIGQAISLDTRIPL
VSFTGSTKVGLMVQQQVNARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQR
CTTCRRLLLHESIYRTFLDQLVEVYKQVRIGDPLENGTLLGPLHTPASRDAFLKGIQTIR
SQGGKILYGGSAIESEGNFVQPTIVEISPSAPVVREELFGPVLYVMKVQNLKEAVEINNS
VPQGLSSSIFTKRPDIIFKWIGPHGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGS
DSWKQYMRRATCTINYGSELPLAQGINFG
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggggagcttcgcgaggaaggagcaccagttcctcgccgagcttggcctcgcgccgcgg
aaccccgggtccttcgcctgcggcgcctggggcggctcgggccccgtcgtcacgtccacc
aacccgacgaacaaccaggtcatcgcggaggtcgtggaggcgtccgcgcgtgagtacgag
gagggcatgcgcgcctgctacgatgccgccaagacctggatggcgattccagctccaaag
cgaggagaaattgttaggcaaattggtgatgcattgagagcaaagctccatcacctgggc
aggcttgtgtcacttgagatggggaaaattcttcctgaagggattggagaggttcaggaa
atcattgacatgtgtgattatgctgtgggcctaagtcgccagctaaatgggtccatcata
ccatctgaacgcccgaatcatatgatgatggaggtgtggaatcctcttggagttgttggt
gttatcacagcattcaattttccttgtgctgtgctgggttggaatgcctgcatagctttg
gtatgtggaaactgtgttgtctggaaaggtgctccaactactccgttgatcactattgca
atgactaaaatagttgccagtgtattggagaggaacaacttgccaggctcaatttttaca
gcattctgtggtggtgctgacattggccaagcaatttctcttgacacaaggatacccttg
gtttcattcacaggaagcacaaaggttggtctaatggttcagcagcaagtgaatgcaaga
tttggcaaatgccttcttgaacttagtgggaacaatgccattattgtaatggatgatgca
gacattcagctagctgtccgttcagtgttgtttgctgctgttggaacagcaggacaacgc
tgcactacatgtcgtaggctgcttcttcacgaaagcatataccgaacatttcttgatcaa
cttgttgaggtttataaacaagtccgaattggggatcctttggagaatggtacgttactg
gggccattgcacactcctgcttcaagagacgccttcttgaaaggcatccaaaccatcaga
tctcaggggggaaaaattctttatggaggatctgcaattgaatctgagggaaactttgtt
cagccaacaattgtggaaatttcaccctctgcaccggttgtgagagaagaactctttggt
cctgttctttatgtgatgaaagttcagaatctgaaggaagcagttgaaatcaacaattct
gttcctcaaggattgagcagttctatatttacaaagagaccagatattattttcaagtgg
attgggcctcatggtagtgactgtggcattgttaatgtaaatattcccacaaatggtgct
gaaattggtggagcttttggtggagaaaaagctactggtggtggacgagaagcagggagt
gattcgtggaagcagtacatgaggagggccacttgtacgatcaactatggaagcgagctg
cctctagcacaaggaataaattttggctag

DBGET integrated database retrieval system