KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336102
Entry
4336102           CDS       T01015                                 
Name
(RefSeq) indole-3-glycerol phosphate synthase, chloroplastic
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4336102
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     4336102
SSDB
Motif
Pfam: IGPS
Other DBs
NCBI-GeneID: 4336102
NCBI-ProteinID: XP_015636520
LinkDB
Position
4:complement(23362238..23365780)
AA seq 419 aa
MEALAIGSAPPRPPGLALPPLTRHHHLLLHRSKTLAPRRFVAAAPMDAAAAAAGRGGPAP
PRCARAETDSEDAVATTSSPHSAEAAGAAEQGNGAPAPVADAADVEGVDGIRIRRRPVTG
PPVHYVGPFQFRLENEGNTPRNILERIVWDKEAEVSQMKERRPLYMLKGPLENAPPVRDF
VGVLKASFDRTGLPALIAEVKKASPSRGVLREDFEPVQIAQTYEKNGAACLSVLTDAKYF
QGSFDYLDAIRNAGVQCPLLCKEFIVDAWQLYYARLKGADAVLLIAAVLPDLDIKYMLKI
CKILGMAALVEVHDEREMDRVLGIDGVQLIGINNRNLETFQVDISNTKNLLEGERGQTIA
QKGIIVVGESGLFTPDHISFVQNAGVKAVLVGESLIKQEDPGKAIAGLFGKDISPVSAA
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggaagctctcgctatcggatccgcacctccccgcccgccgggcctcgcactcccaccc
ctcacccgtcaccaccacctcctcctccaccgctccaaaaccctagcccctcgccgtttc
gtcgccgccgcgcccatggacgccgccgccgccgccgccggccggggcggccccgcccct
ccccgctgcgcccgcgccgagacggattcggaggatgcggtcgcgacgacaagctcgccg
cactccgccgaggccgcgggcgcggcggagcaggggaacggggccccggccccggtggcg
gatgccgccgacgtcgagggggttgacgggataaggatccggaggcgccccgtgaccggg
ccgccggtgcactacgtggggccgttccagttccgcctcgagaacgaggggaacacgccg
cggaacatcctcgagaggatcgtgtgggacaaggaagccgaggtttcacagatgaaggag
agaaggccactgtacatgctgaaggggccgctggagaatgctcctccggtgagggatttc
gttggggtgttgaaggcgtcttttgatcggactggtctgcctgctctgattgcagaggtc
aagaaggcttcaccgagccgcggtgtcctgagggaggacttcgagccggttcagatcgcc
caaacatatgagaaaaatggagcagcatgcttaagtgttctcacagatgcaaaatacttt
cagggaagttttgactatttggatgctatacgcaatgctggagtacagtgtcctctgctg
tgcaaagagttcattgttgatgcctggcaactttactatgcgcgtttgaagggagcagat
gctgttcttctgattgctgctgtcttacctgatcttgatatcaagtatatgttgaaaata
tgcaaaatacttggcatggctgctttagttgaggtgcatgatgaaagggaaatggaccgt
gtgttagggatagatggtgtccagctcatcggcatcaataaccgtaacctcgagactttt
caagttgatatttcaaacactaaaaatcttcttgagggtgaaagaggacaaactatagct
cagaaaggcataattgttgtaggggaatcagggctgttcacaccagaccatatttcattc
gttcagaatgctggggttaaagctgttctcgttggggagtctctcatcaagcaggaggat
cctggcaaagcaatcgctgggcttttcggcaaagacatctcacctgtgagtgctgcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345257
Entry
4345257           CDS       T01015                                 
Name
(RefSeq) indole-3-glycerol phosphate synthase, chloroplastic
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4345257
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     4345257
SSDB
Motif
Pfam: IGPS Phage_T7_55
Other DBs
NCBI-GeneID: 4345257
NCBI-ProteinID: XP_015651034
LinkDB
Position
8:13954457..13958413
AA seq 384 aa
MESLLASPSVYRASFPCASSASRSPSRARLAVTPAGAGARARARSLLRCGAKDSILEELA
QDDMVNAVELAQWENGKSINDIAASQGIRIRRHCRPNVPLKEIEEELGAPRNILEKIIWD
KEVEVAEGHAKKPLKEVIEAAGQAPPARDFYGALASAFKRNGMPALIAEVKKASPSRGVL
RENFNPVEIAQAYEKNGAACLSILTDEKYFQGSFENLAKVRKSGVKCPLLCKEFVIDKWQ
IYYARSQGADAILLIAAVLPDLDIKYFLRICKELGMTALIEVHDEREMERVLNISGVQLI
GINNRSLETFVVDTSNTKMLLDMHGDTIREKGILVVGESGLFNPDDVAYVQNAGVSAVLV
GESLVKQDDPGRAIAGLFGKELLH
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggagtccctcctcgcctcgccctctgtctacagggcttcctttccctgcgcctcctcc
gcctcccgctccccgtcgcgggctcgcctcgccgtcacgcccgccggcgccggcgcccgc
gcccgcgcccgctcgctcctccgctgcggggccaaggactccatactcgaggagctagcg
caggacgacatggtgaacgcggtggagctagcgcagtgggagaacggcaagtcgatcaac
gacatagcggctagtcaagggatccgcatccgcaggcactgccgtcccaatgtccccttg
aaggagatcgaggaggagctgggtgctccccgcaacatcctggagaagatcatttgggac
aaggaggttgaggtagccgaggggcatgccaagaagcctctcaaggaggtgattgaggct
gcagggcaggctcctcctgcaagagacttctacggtgctttagcatcagccttcaagcgc
aatggtatgccagcgttgatcgctgaggtcaagaaggcatcgccaagtaggggtgtgctc
agggagaacttcaatcctgttgaaattgctcaggcttatgaaaagaatggtgctgcatgc
ttgagcatcttgaccgatgagaagtattttcagggaagttttgaaaatctcgcaaaggtg
cggaagtcaggagtgaagtgccctctcctatgcaaagagtttgtcatcgataaatggcag
atctattatgcccgctctcagggcgcagatgcaattctgcttattgccgctgtgctacct
gatctcgacataaagtacttccttcgcatatgtaaggagttgggaatgacagctcttatt
gaggttcatgatgaaagggagatggagcgtgtgctgaatataagtggagttcagcttatt
ggcatcaataaccgcagccttgaaacatttgttgtcgatacttcaaacacaaagatgttg
ctagatatgcatggtgataccatcagggagaagggaatattggttgttggcgaatcaggg
ctgttcaacccagatgacgttgcttatgtgcaaaatgctggagtttccgctgttttggtg
ggagaatccctggtcaagcaagacgaccctggacgagccattgctgggctcttcgggaaa
gaacttttgcattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346529
Entry
4346529           CDS       T01015                                 
Name
(RefSeq) indole-3-glycerol phosphate synthase isoform X1
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4346529
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     4346529
SSDB
Motif
Pfam: IGPS
Other DBs
NCBI-GeneID: 4346529
NCBI-ProteinID: XP_015612572
UniProt: Q6K306 A0A0P0XJ02
LinkDB
Position
9:complement(4201058..4204437)
AA seq 385 aa
MESLLAASSSLPAAAFSPPSSLSSTSSSPHALRSAVAGAARAVRCSAAKDSILYALEHDE
MFNSAEVIQWESGKSINSIAAAQGIRIRRRCRPRYPSEGSGADKAVPRNMLEQIIWDKEV
EVSQRKAKKPLQKVIESSQHAPPARDFVGALTAAYSRNVAPALIAEVKKASPSRGVLRED
FNPVEIAQSYEKNGAACLSILTDEKHFQGSFENLETVRNSGVKCPLLCKEFVIDIWQIYY
ARSKGADAILLIAAVLPDLDIKYMLRICKNLGMTALIEVHDERELDRVLKIDGVQLIGIN
NRSLETFKVDTSNTKTLLEKRGDLIRDKGILVVGESGLFTPDDVAYVQNAGVSAVSLLIT
RFQLSWSYMCFKFPAEILYGTSEMD
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggagtccctcctcgccgcctcttcctctctccccgcggccgccttctcgccgccgtcg
tccctctcttcgacctcctcgtcgccgcacgccctacggtcggccgtcgccggagccgcc
cgcgcggtgcgctgctccgccgccaaggattcgatcctgtacgcgctggagcacgacgag
atgtttaactcggcggaggtgatccagtgggagagcggcaagtccatcaactccatcgcc
gccgcgcagggcatccgcatccgccgccgctgccgcccacgctacccctccgagggctcc
ggcgccgacaaagccgtcccccgcaacatgctcgagcagatcatctgggacaaagaggtc
gaggtgtcccagaggaaggcgaagaagccgctgcagaaggtgatcgagtcgagccagcac
gcgccaccggccagggacttcgtcggcgcgctaacggcggcctacagccgcaacgtcgcg
ccggcgctgatcgccgaggtgaagaaggcgtcgccgagcagaggcgtgctccgggaggac
ttcaatccggttgagatcgcgcaatcctatgagaagaacggcgcggcttgcctcagtatc
ctgaccgacgaaaaacactttcagggtagctttgagaatctcgagaccgttcgcaattcc
ggagtaaagtgccctcttctttgcaaggagtttgtgatagatatctggcaaatctattac
gctcggtcaaagggtgcggatgcaattctgttgattgctgccgtgttacctgatctcgac
atcaagtacatgcttcgcatctgcaagaacctcggaatgacagctctcatagaggttcat
gatgagagggagctggatcgtgtgctcaaaatagatggcgttcagcttatcggcatcaat
aaccgaagtttagagacgtttaaggttgatacttcaaacacaaagaccctgttggagaaa
cgtggtgacctcataagggataaagggattctggttgttggtgaatctggtcttttcacg
cctgatgatgttgcatacgtgcagaatgctggtgtttctgcagtaagtttactgattacc
cgttttcagctaagttggtcatacatgtgcttcaaatttccagctgaaatattgtacgga
acgtctgaaatggattaa

DBGET integrated database retrieval system