KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336126
Entry
4336126           CDS       T01015                                 
Name
(RefSeq) probable WRKY transcription factor 2 isoform X1
  KO
K18835  WRKY transcription factor 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4336126
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4336126
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    4336126
SSDB
Motif
Pfam: WRKY
Other DBs
NCBI-GeneID: 4336126
NCBI-ProteinID: XP_015634497
UniProt: Q7XAA9 Q0JCG6
LinkDB
Position
4:complement(23579700..23587182)
AA seq 998 aa
MTMTTATLDPPPPPLLIAGSLLDDDRDAGSAASSSPRWLPRARGSTVGSPPRRGGEERGG
EAATRRKGNSSCPDDDDDCRNDEDDCRNDDDYRDDDVGATTDGGGDAAALLPMAMMTATT
MAPMPVEAAVDGGGELSSAGEGGQRRVNLLPTKILSAYENHLFSQALACREDEWIIEKLA
VIAARRSSFVSEESLCSVPAAALVSLAIAHLAFSPMLVYGVLDRLCSVCHLGEMEGDIAM
EEWKDSNHRGADYLMTMPMQNFLADAFPPPELLEGEGGFEKHGLSVAVGSPPPTPPPPED
GCSPLPLTPQFGQKFGSGGGGGGSLADRRARGGFSNVARISVPYNQPAADVSSAGAPSPY
VTIPPGLSPTTLLESPVFSNAMGQASPTTGKLHMLGGANDSNPIRFESPRIEEGSGAFSF
KPLNLASSHYAAEEKTKSLPNNQHQSLPISVKTEATSIQTAQDEAAANQLMQPQFNGGKR
SRAAPDNGGDGEGQPAEGDAKADSSSGAAAVAVVAAAAAAVAEDGYSWRKYGQKQVKHSE
YPRSYYKCTHASCAVKKKVERSHEGHVTEIIYKGTHNHPKPAASRRPPVHPPPPSPATTT
TTPLPPGDAQADHAPDGGGGSTPVGAGQAGAEWHNGGVVGGEGLVDATSSPSVPGELCES
TASMQVHEGAAAAQLGESPEGVDVTSAVSDEVDRDDKATHVLPLAAAAADGESDELERKR
RKLDSCATMDMSTASRAVREPRVVIQTTSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKC
THPGCLVRKHVERASHDLKSVITTYEGKHNHEVPAARNSGHPAGSASPGGGAGSSSQPHG
VGVGGRRPEVPSVQESLMRLGGGCGAAPFPPHFGLHLPPPPPRDPLAPMSNFPYSLGHAP
SPALRGLPPPPPPPPSASALAVAGLGGVVEGLKYPMLAPPSVHSLLRHRQGGGMEAVVVP
KAEVKQEAMRPAAAVAGAGRGAAVYQQAMSRVSLGNQL
NT seq 2997 nt   +upstreamnt  +downstreamnt
atgacgatgacgaccgcgacgctggatccgccgccgcctcccctcctcatcgccggctcc
ctcctcgacgacgatcgcgacgctggatctgccgcctcctcctctcctcgctggctcccc
cgggcgcgcggatccaccgtcggctcccctcctcgccggggaggggaggagaggggaggg
gaggcggcgacgaggaggaaaggcaacagctcctgtcctgacgacgacgatgactgccgc
aacgacgaggacgactgccgcaacgacgacgactaccgcgacgatgatgtgggggcgacg
acggatggaggaggagacgcggcggctcttctcccgatggcgatgatgactgccacgacg
atggcgccgatgcctgtcgaggcagcggtggacggaggaggagagctgtcatcggccgga
gagggtggccagcggcgggtgaatctactgcctacgaagatattgtccgcctacgaaaat
catctattttcgcaggcccttgcttgcagggaagatgaatggatcatcgagaagcttgcg
gtcatcgctgctagacgctcatcatttgtctctgaagaatccttgtgctctgttccggct
gcggctttggtctctttggccattgcccatttggctttctcccccatgttggtctatggc
gttcttgatcgtttatgttccgtttgccatctgggtgagatggagggagacatagcgatg
gaggagtggaaggattccaaccatcgaggcgcggattacctgatgacgatgccgatgcag
aacttcctcgccgacgcgttcccgccaccggagctcttggagggagaaggcgggttcgag
aagcacggcctgtcggtggccgttggctcgccgccgccgacgccgccgcctccggaggac
gggtgctcgccgctgccactgacgccgcagttcggccagaagttcggctccggcggcggc
ggcggcggcagcctcgccgacaggagggcgagaggcgggttcagcaacgtcgccaggatc
agcgtgccgtacaaccagccggcggcggacgtgtcgtcggcgggggcgccgtcgccgtac
gtgacgatcccgcccggcctgagcccgacgactctgctggaatcgccggtcttctccaat
gccatgggccaggcctcgccgaccactgggaagctgcacatgcttggtggtgccaacgac
agcaatccaatcagatttgaatcccctcggatcgaagaaggatctggtgcattttctttc
aagcctctgaatctcgcatcctcacactacgcagctgaagaaaagacgaaatctctaccc
aacaaccagcatcagtcgctaccgatttctgtcaagactgaagctactagcattcaaacc
gcacaagatgaagcagcagccaaccaactgatgcagccgcagttcaacggcggcaagcgg
agccgcgctgcacctgacaacggcggcgacggcgagggccagccggcggagggcgacgcg
aaggctgactcctcctccggcgcggccgcggtcgccgtcgtcgccgccgccgcggcggcg
gtggcggaggacgggtacagctggaggaagtacgggcagaagcaggtgaagcacagcgag
tacccgaggagctactacaagtgcacgcacgccagctgcgcggtgaagaagaaggtggag
cgctcgcacgagggccacgtcacggagatcatctacaagggcacccacaaccaccccaag
ccggcggcgagccgccgcccccccgtccatcctccgccgccgtcgccggcgacgacgacg
acgacgccgctgccgccaggcgacgcgcaggccgaccacgcgcccgacggcggcggcggc
agtaccccagttggcgccggacaggcgggcgcggagtggcacaacggcggcgtggttggc
ggcgaggggctggtggacgcgacgtcgtctccctccgtccccggcgagctctgcgagtcg
acggcgtcgatgcaggtccatgaaggcgcggcggcggcgcagctgggggaatcccccgag
ggcgtcgacgtcacgtctgcggtgtccgacgaggtggacagggatgacaaggcgacgcac
gtgttgcccctggccgccgccgccgccgacggcgagagcgacgagctggagcgaaagaga
aggaagctggactcctgcgccaccatggacatgagcacggcgtcgagggcggtgcgcgag
ccgcgggtggtgatccagacgacgagcgaggtggacatcctcgacgacggctaccgctgg
cgcaagtacgggcagaaggtcgtcaaggggaaccccaacccaaggagctactacaagtgc
acgcacccggggtgcctggtgcggaagcacgtggagcgcgcgtcgcacgacctcaagtcg
gtgatcaccacgtacgaggggaagcacaaccacgaggtccccgcggcgaggaacagcggc
cacccggcgggctcggcttcgcccggcggcggcgcggggtcgtcgtcgcagccccacggc
gtcggcgtcggcgggcgcaggccggaggtgccgtcggtgcaggagagcctgatgaggctc
ggcggcggctgcggcgcggcgccgttcccgccccacttcggcctgcacctgccgccgccg
ccgccgagggacccgctcgcgccgatgagcaacttcccctactcgctcggccacgcgccg
tcgccggcgctgcggggcctgccgccgcccccgcccccgccgccgtcggcgtcggcgctg
gcggtggcggggctcggcggcgtggtggaggggctcaagtacccgatgctggcgccgccg
tcggtgcactcgctgctgaggcaccgccagggcggcggcatggaggcggtggtggtcccc
aaggcggaggtgaagcaggaggcgatgcggcccgccgccgccgtcgccggcgcggggcgc
ggcgcggcggtgtatcagcaggcgatgagcagggtgtcgctggggaatcaactgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345940
Entry
4345940           CDS       T01015                                 
Name
(RefSeq) probable WRKY transcription factor 2
  KO
K18835  WRKY transcription factor 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4345940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4345940
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    4345940
SSDB
Motif
Pfam: WRKY
Other DBs
NCBI-GeneID: 4345940
NCBI-ProteinID: XP_015650158
UniProt: A0A0P0XHP3 Q6ZKN0
LinkDB
Position
8:complement(24645859..24649903)
AA seq 674 aa
MDGTNNHGALMDDWMLPSPSPRTLMSSFLNEEFSSGPFSDIFCDNGSNKHQDGLGKSKAF
IDSSREETAQLAKKFESNLFGANQKSSSNGCLSERMAARTGFGVLKIDTSRVGYSTPIRS
PVTIPPGVSPRELLESPVFLPNAIAQPSPTTGKLPFLMHSNVKPSIPKKTEDETRHDRVF
FFQPILGSKPPTCPVAEKGFSVNHQNQPSVTDNHQELSLQSSSTAAKDFTSATIVKPKTS
DSMLDNDDHPSPANDQEENATNKNEEYSSDLIITPAEDGYNWRKYGQKQVKNSEHPRSYY
KCTFTNCAVKKVERSQDGQITEIVYKGSHNHPLPPSNRRPNVPFSHFNDLRDDHSEKFGS
KSGQATATSWENAANGHLQDVGSEVLTKLSASLTTTEHAEKSVMDKQEAVDISSTLSNEE
DDRVTHRAPLSLGFDANDDYVEHKRRKMDVYAATSTSTNAIDIGAVASRAIREPRVVVQT
TSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCSVRKHVERSSHDLKSVITTYEG
KHNHEVPAARNSGHPSSGSAAAPQATNGLLHRRPEPAQGGGGGSLAQFGYGSAGHRPAEQ
FGAAAAGFSFGMLPRSIATPAPSPAIAVPAMQGYPGLVLPRGEMKVNLLPQSGNAGAAAS
QQLMGRLPKQHPQM
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggacgggaccaacaaccatggagcactgatggacgattggatgcttccctcacccagt
ccaagaacactcatgtcgagtttcttgaacgaagaattcagctccggtcccttttcagac
attttctgtgataatggcagtaacaaacatcaggatggacttgggaagagcaaagctttc
atcgattcaagccgggaagaaactgctcagctagcaaaaaagtttgaatcaaaccttttt
ggtgccaaccagaaatcaagctcaaatggctgtctgtcagagaggatggctgcaaggaca
ggttttggtgtcctgaaaattgatacatctcgtgtcggttattctacaccgattcggtct
ccggtgacgatcccgcccggtgtgagtccaagggaacttcttgagtcgccggtttttctt
ccgaacgccattgcacaaccttctcctaccactggcaaactgccatttttgatgcatagt
aatgttaaaccatcgatccctaaaaaaactgaagatgaaacacgccatgatcgtgtattc
ttctttcaacccattttgggatctaagccaccaacttgtccagttgcagagaagggtttc
agtgttaatcatcaaaaccagccttcagtgacggataatcaccaggagctcagtcttcag
tctagctcaactgcagccaaggatttcacttcagcaactattgttaaacctaagacatct
gattccatgttagacaatgatgatcacccttcccctgcaaatgatcaagaagagaatgca
acaaacaaaaatgaagagtattcttcagacctgatcattacccctgctgaggatggatat
aactggaggaaatatggacagaagcaagttaagaacagtgagcatcccagaagctactac
aaatgcactttcacgaattgcgctgtcaagaaggtggagcgttctcaagatggccaaata
acagagatagtctacaaaggttctcacaatcaccctttgccgccttccaaccgccgacca
aatgttcctttctcacacttcaatgatctgagagatgatcactctgagaaatttggttcc
aagtctggtcaggccacagcaacttcatgggagaatgccgcaaatggacacctccaagat
gtcggtagtgaagttctgacaaaactgtctgcttctcttacgacaacagaacatgctgaa
aaatctgttatggacaaacaagaagctgtggatatctcatcgacgctctccaatgaagag
gatgatagggtaacgcatcgtgccccgctttctctgggctttgatgcgaacgatgactat
gttgaacacaagagaagaaagatggatgtttatgccgctactagcactagcaccaacgcc
atcgacataggagctgtggcgtcaagagctatccgggagcctcgcgttgttgttcagacc
acaagtgaggttgacatccttgatgatggttaccgttggcgcaagtatgggcagaaagtt
gtcaaaggaaacccaaatccaaggagctactacaagtgcactcatccgggttgctcggtg
cgcaagcatgtggagcgatcatcgcatgatctgaaatccgtcatcacgacgtatgaagga
aagcacaaccatgaagttccagctgccaggaacagtggccacccaagctcaggctcagcc
gctgcaccacaggctaccaatggtcttcttcaccggagacctgaaccggcacaaggtggt
ggtggtggtagccttgctcagtttggctatggctcagctggtcacagaccagcagagcag
tttggtgcagcagcagctggtttctcctttggaatgctgcctcgtagcattgcaactccg
gcgccgtctccggcgatcgccgtgccggcgatgcaggggtacccagggcttgtgctgccg
agaggtgagatgaaggtgaacttgctgccacagtctgggaatgctggtgcagcagctagc
cagcagctgatgggcaggttgccaaagcagcatcctcagatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347399
Entry
4347399           CDS       T01015                                 
Name
(RefSeq) probable WRKY transcription factor 2
  KO
K18835  WRKY transcription factor 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4347399
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4347399
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    4347399
SSDB
Motif
Pfam: WRKY Bac_luciferase
Other DBs
NCBI-GeneID: 4347399
NCBI-ProteinID: XP_015612220
UniProt: B9G475 Q0J0V4
LinkDB
Position
9:complement(18496965..18501401)
AA seq 633 aa
MASSSDHGSLMEDWMPPPTPSPRTLMSSFLNEDFVSGSFSNIFSDHESNKPQDQFERNRE
LVDLSKEVPSQFARPAFQRDASLDHSLVSPTQRSNSHGGLAERRAARAGFSVPKIDTSRG
GSSTVIRSPVAIPPGLSPTTLLESPVFLYNAMAQPSPTTGTLPFLMASNAKSTIPSATKM
DEDCTFGNDTFSFQPHVGSRRPNFSAAEKGPNACHQNQSLSNIHQRESSLQSSFTAVKDI
TDEKNIKTKTSDSMFGDNHSSDEQDDETNQNGENSMPPPNHRSGVPLSHTNDPEVNVLEN
RGSQTCHNSASLWDNAKNDCLQDVQSEVIETRTAACLPVSTNCDTSIMESQDAVDVSSTL
SNEEDDRATHGTASIECNGDGDETDSKRRKLDALTAATAAITTTSNIDMGAAASRGVREP
RVVVQTTSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKCTHQGCSVRKHVERASHDLKSV
ITTYEGKHNHEVPAARNSGHGSSGSGNAPSAPQSNGSQRRQEQGQASFSQFGGAAPFSSF
VLPPRNQFGPSASNFPFGMVPPGMAIPMPSLGSLAPAKMAGHPSTMQGYQGLMIPEGEMK
TEPMSQLGFPAVNQSSSSFQQMMNRPPSFGPQM
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggccagcagtagcgaccatggatccctcatggaggactggatgccaccacccacaccc
agcccgagaacactcatgtcaagcttcttgaatgaagattttgtctctggttcattttcc
aatattttcagtgatcatgagagcaacaaaccccaggatcagtttgagagaaacagagag
cttgtggatttgagtaaggaagtgccttcccaattcgcaagacccgcattccagagggat
gcttccctggatcatagcttggtcagtcctacacagagatcaaactcgcatggtggtttg
gcagagcgcagggctgcgagggctggtttcagtgtcccgaaaatcgatacatcccgtggt
ggttcatccacagtaattcgatcgcccgtggcaattccaccaggtcttagtccaacaaca
cttctcgagtcaccggttttcctttacaacgcaatggcacagccttctccaaccactggc
acactgccatttttgatggcttcaaatgctaagtcaacaataccgtcagctaccaagatg
gacgaagattgcacatttggcaatgacactttctccttccaaccgcatgtagggtcgaga
cggccaaatttctccgctgcagaaaagggtcccaatgcttgtcaccaaaaccaatcgctg
tcgaatatccatcagcgggaatccagtcttcagtcaagctttactgcagtcaaagatatc
actgatgaaaaaaacattaaaacaaagacatctgactccatgtttggtgataaccactct
tctgatgaacaagatgatgagactaaccaaaatggagaaaactctatgccacctccgaac
caccgttcaggtgtccctctgtcacataccaatgatccagaagtgaatgtcctagagaac
cgcggttcacagacatgccataactctgcatccttgtgggacaatgccaaaaatgattgc
cttcaagatgttcaaagtgaagttattgaaacaagaacagctgcttgtcttccagtatca
accaattgtgatacatctatcatggagtcccaagatgcagttgatgtgtcgtcaacacta
tctaatgaggaggatgatagggcaacgcatggcacggcttctatagagtgcaacggggat
ggagatgagactgattccaagagaaggaagctggatgctttgacagctgcaactgctgct
attaccaccaccagtaacattgacatgggagctgcggcatcgagaggtgtccgggagcct
cgtgttgttgttcagacaacaagtgaggttgacatccttgatgacggttaccgctggcgc
aagtatggacagaaggttgttaaaggaaatccaaacccaaggagctattacaaatgtacg
caccaagggtgttcggtgcgcaagcacgtggagagagcatcgcatgatctaaaatccgtc
atcacgacgtacgaggggaagcacaaccatgaagttccagctgccagaaatagtggacat
gggagctctggatctggaaacgctccatctgcaccgcaatctaacggctctcagcgcagg
caagaacaagggcaagccagcttcagccagtttggtggcgcggctcccttcagctccttc
gttctcccaccaagaaaccaatttggaccatcggcgagcaatttcccctttgggatggtc
ccgccaggcatggcgattcccatgccatctctagggtctcttgctccagcaaagatggct
ggtcatccatccaccatgcagggctaccaggggctcatgattccggaaggagagatgaag
acagagcccatgtcgcagctcggcttccccgcggtaaaccaatcttcatcatccttccaa
cagatgatgaacaggcctccatcatttggacctcagatgtaa

DBGET integrated database retrieval system