KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336245
Entry
4336245           CDS       T01015                                 
Name
(RefSeq) phosphoglycolate phosphatase 1B, chloroplastic
  KO
K19269  phosphoglycolate phosphatase [EC:3.1.3.18 3.1.3.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4336245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4336245
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     4336245
    3.1.3.48  protein-tyrosine-phosphatase
     4336245
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   4336245
SSDB
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase NuA4
Other DBs
NCBI-GeneID: 4336245
NCBI-ProteinID: XP_015636788
UniProt: Q7X7H3 Q7F985
LinkDB
Position
4:complement(24527972..24530518)
AA seq 365 aa
MLLTRASPTFLPSTSAASPSPQQAPSSPTFGRSQYRRGGGLVSVSSPVAGQRCAARRRSV
MAAAGAVPAAKLENADALIDSVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRLVFV
TNNSTKSRKQYGKKFETLGLNVNEEEIFASSFAAAAYLQSIDFPKDKKVYVIGEDGILKE
LELAGFQYLGGPSDGDKKIELKPGFYMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENP
GCLFIATNRDAVTHLTDAQEWAGGGSMVGAILGSTKQEPLVVGKPSTFMMDYLAKKFGIT
TSQICMVGDRLDTDILFGQNGGCKTLLVLSGVTSVQMLQSPDNSIQPDFYTNQISDFLTL
KAATV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctcctgacgcgcgcctcccccaccttcctcccctccacctccgccgcctcgccctcg
ccgcagcaggcgccgtcctccccgaccttcgggaggagccagtaccgccggggaggtgga
ttggtctccgtttcttctccggtggccggtcagcgctgtgctgccaggaggaggtccgtg
atggcggcggccggcgcggtccccgcggcgaagctggagaacgccgacgcgctcatcgac
tccgtcgagacgttcatattcgattgcgacggtgtgatttggaagggcgacaagctgatc
gacggagtgccggagacgctcgacatgctcagatcaaagggcaagaggctggtgttcgtg
acgaacaactcgaccaagtcgaggaagcaatacgggaagaagtttgagacgctgggacta
aacgtcaatgaggaagagatcttcgcttcgtcgttcgcagctgccgcgtacctgcagtcc
atcgatttccccaaagacaagaaggtttatgtgattggagaggacgggattctgaaggag
ctggagctggctggatttcagtacctcggcgggccatctgatggagacaagaagatagag
ctgaagcctggattttacatggaacatgacaaagatgttggagcagttgttgtgggattc
gatcgctattttaactactacaaagtacagtacgggacactgtgcattcgtgagaatcca
gggtgccttttcattgccacaaaccgggacgccgtcacccatcttactgatgcccaagag
tgggcaggtggagggtcaatggttggtgcaattcttggttcaactaaacaagaaccgctc
gttgtcgggaagccgtcaacattcatgatggactacctggcaaagaagtttgggatcaca
acatcccagatatgcatggttggtgaccgtttggataccgacatcttgtttggccaaaac
ggaggttgcaaaactcttctggtcctttcaggtgtcacttctgtacagatgcttcagagc
cctgacaactcgatccagccagatttctacacaaaccaaatttctgattttctcaccctc
aaagcagcaactgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346547
Entry
4346547           CDS       T01015                                 
Name
(RefSeq) phosphoglycolate phosphatase 2
  KO
K19269  phosphoglycolate phosphatase [EC:3.1.3.18 3.1.3.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4346547
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4346547
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     4346547
    3.1.3.48  protein-tyrosine-phosphatase
     4346547
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   4346547
SSDB
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase DUF4270
Other DBs
NCBI-GeneID: 4346547
NCBI-ProteinID: XP_015612535
UniProt: A0A0P0XJ25 Q6EP66
LinkDB
Position
9:complement(4535277..4543638)
AA seq 303 aa
MANGLPNPLLTADAARSLVDSVDAFLFDCDGVIWKGDQLIEGVPETLDLLRKMGKKLVFV
TNNSRKSRRQYAKKFRALGLEVTEEEIFTSSFAAAMFLKLNNFSPEKKVYVVGEDGILEE
LRLAGFECLGGPEDGKKNILLEANFYFEHDKSVGAVIVGLDQYFNYYKMQYASLCIRENP
GCLFIATNRDPTGHMTSVQEWPGAGTMVAAVSCSVQKEPIVVGKPSSFLMDFLLKSFNLE
TSRMCMVGDRLDTDILFGQNTGCKTLLVLSGVTTLPELQDASNTIHPDLYTNSVYDLVGL
LQQ
NT seq 912 nt   +upstreamnt  +downstreamnt
atggccaacgggctccccaaccccctcctcaccgccgacgccgcccgatccctcgtcgac
tccgtcgacgccttcctcttcgactgcgacggggtgatttggaagggggatcagctaatc
gaaggggtccctgagactttggacctcctgcggaaaatgggcaagaaattagtttttgta
acgaacaactctagaaagtcgagaagacagtatgcgaagaagttcagagcacttggactt
gaagttacagaggaagagatctttacatcatcatttgcagcagccatgttcttgaagtta
aataatttctctccagaaaagaaggtttatgttgtcggtgaggatggtattttggaagag
ctcagattagccggttttgaatgtttaggtggcccggaggatggcaagaaaaacatattg
ctggaggcaaacttctactttgaacatgacaaaagtgttggagctgtcattgttggactt
gatcagtacttcaactactacaaaatgcagtatgcgagcttgtgtattcgtgagaatcca
ggctgtcttttcattgcgaccaaccgtgatcctactggtcatatgacatccgttcaagaa
tggccaggagcgggaactatggttgctgctgttagttgctctgtgcagaaagagcccatt
gttgttggaaaaccttcaagctttttaatggacttcctcttgaaaagcttcaatttggag
acatcaagaatgtgcatggtcggtgacagactagacactgacatactatttggccagaac
actggttgcaaaacactacttgttctgtctggcgtgactaccttaccagaacttcaggac
gcttcaaatactatccatccagatctttatacaaacagcgtatatgatctggtgggatta
ttgcaacagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271010
Entry
9271010           CDS       T01015                                 
Name
(RefSeq) phosphoglycolate phosphatase 1B, chloroplastic isoform X1
  KO
K19269  phosphoglycolate phosphatase [EC:3.1.3.18 3.1.3.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    9271010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    9271010
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     9271010
    3.1.3.48  protein-tyrosine-phosphatase
     9271010
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   9271010
SSDB
Motif
Pfam: Hydrolase_6 ProQ SIS
Other DBs
NCBI-GeneID: 9271010
NCBI-ProteinID: XP_015620632
LinkDB
Position
12:complement(13094840..13096931)
AA seq 236 aa
MLTPVVAAAAAAPARSRWPSWRTPPRSSTPSRRSYLTATQRRCDLEGREADRRSARDARH
ARSKGKRLVFVTNNSTKSRKQYGKKFETLGLNVNEEEIFASSFAYVAYLQSIDFPKDKKV
YVIGEDGILKELELAGFQYLGGPSDGDKKIELKPGFYMEHDKDVTTIPTSTRHLFHMYRM
VVGDSVSTASSVCCATPVDLQSAKRRPMCTIFLYTLILDMAKSGVEFEAALFYSDG
NT seq 711 nt   +upstreamnt  +downstreamnt
atgctcacacccgtcgtggcggcggcggcggcggcgccggcgcggtcccggtggccaagc
tggaggacgccgccacgctcatcgactccgtcgagacgttcatatttgactgcgacgcag
cgtaggtgtgatttggaagggcgagaagctgatcgacggagtgctagagacgctcgacat
gctagatcaaagggcaagaggctggtattcgtgacgaacaactcgaccaagtcgaggaag
cagtacgggaagaagtttgagacgctaggactaaacgtcaatgaggaagagatcttcgct
tcgtcgttcgcatatgtggcgtacctgcagtccatcgatttccccaaagacaagaaggtt
tatgtgattggagaggacgggattctgaaggagctggagctggctggatttcagtatctt
ggcgggccatctgatggagacaagaagatagaactgaagcctggattttacatggagcat
gacaaagatgtaactacgatccctactagcactcgccacctatttcatatgtatagaatg
gtagttggtgattccgtatctacagcttcttctgtatgttgcgctactcctgttgatctt
caatccgcaaaaagaaggccgatgtgtaccattttcctttatacattgattttggacatg
gccaagtcaggagtggagtttgaggctgcccttttttattctgatggttga

DBGET integrated database retrieval system