KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336259
Entry
4336259           CDS       T01015                                 
Name
(RefSeq) uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1
  KO
K01148  poly(A)-specific ribonuclease [EC:3.1.13.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4336259
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4336259
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     4336259
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     4336259
SSDB
Motif
Pfam: CRS1_YhbY NikR_C SRP54
Other DBs
NCBI-GeneID: 4336259
NCBI-ProteinID: XP_015636442
UniProt: A0A5S6R8N5 Q7XSB6
LinkDB
Position
4:24644137..24647863
AA seq 479 aa
MGSRVLLLRRMEKGWRPMSRALYPSPGSTSVAPPHELRAPRRCSPSYTSHKVFHRDVGFF
SGWQSYNLQIYCCIHTSRPVNSQNHTIAEPQQKQEDVALVDESGRPKAKRKKLKGRRAVT
RFLKSLRWKKKREFQRMTAEEKILYKLKLARNKEERLVAALTKIEPDDPSEPTHDPEVLT
PEEHFYFLKMGQKSKNYVPVGRRGIYQGVILNMHLHWKKHQTLQVIVKTFTPDEVKEIAS
ELARLSGGIVLDIQEGNTIIMYRGKNYAQPPPEIMSPKVTLPRKKALDKSKYRERLRALR
RYIPRLEQELVDLHAQMKLARDYKGQNAAEDITCISDSVNSTSAKEYSSCSVRKRSVSDL
LSESIEGSGRLEDENYEVSADSASESITYSESEDLSDIFETDSEEEQVQESKEQPLYLDK
LDKFPSENNDNEPDDFEEHLRKIASLSDRTDSSAKELKVSELDEIDKIFLRASSLLKKR
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgggcagccgggtgctcttgctccggaggatggagaaggggtggcggccgatgtcccgg
gcgctttatccctcccccggttctaccagcgtggcgcctccccatgagctgcgcgcgcct
cggcggtgctcaccatcttatacttcccacaaggtttttcaccgagatgttgggttcttc
agtgggtggcaaagttataaccttcaaatatattgctgtatccatacaagccgaccagtc
aatagtcaaaatcataccatagcagaacctcagcagaaacaagaagatgttgcgctggtt
gatgaatctggtaggcccaaagcaaagaggaaaaagttaaaaggaaggagggcagtgaca
agatttttgaaatccctgagatggaagaagaaaagggagtttcaaaggatgactgcggag
gagaagattttgtacaaactgaagctagctcgaaacaaggaagaacgacttgttgcagct
ttgacgaagattgaaccggatgacccatcagaacctacccatgatcctgaggtgcttaca
cctgaagagcacttctatttcctcaagatgggtcaaaaaagtaaaaattatgtgcctgta
ggaagacgtggaatatatcagggagtgatcctgaacatgcatttgcactggaaaaagcac
caaacgctacaggtaattgtgaagacattcacaccagacgaggttaaggaaattgcctca
gagttagccagactaagtggtggaattgtgctggatattcaagaagggaatacgattatt
atgtacagaggaaaaaactatgcacagccaccacctgaaataatgtctccaaaagttaca
cttcctagaaaaaaggcactggataaatcaaaatacagagaacgcctccgagctcttagg
cggtacattcccaggcttgagcaggagcttgtagatcttcatgcacagatgaagttagct
agagattataaaggacagaatgcagcggaagatattacttgtatttcagatagtgtaaac
agtacatctgcgaaagaatattcttcttgctcagttcgcaagagaagtgtatctgatctc
ctgtcagaaagtatagaagggtctggaaggctagaggatgaaaattatgaggttagtgct
gattcggcttcagagtctatcacatactctgaatccgaggatctctctgacatttttgag
acggactcagaggaggagcaggtacaggaaagcaaggagcaaccgttgtatctagataag
ctggataagtttccctcagaaaataatgacaatgaaccagatgatttcgaagagcatcta
cgaaagattgcttccctttctgataggaccgattcatctgctaaagaactcaaagtatcc
gagcttgatgagattgataaaatcttcttgagagctagttcattgctgaagaaaaggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345682
Entry
4345682           CDS       T01015                                 
Name
(RefSeq) poly(A)-specific ribonuclease PARN-like
  KO
K01148  poly(A)-specific ribonuclease [EC:3.1.13.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4345682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4345682
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     4345682
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     4345682
SSDB
Motif
Pfam: CAF1
Other DBs
NCBI-GeneID: 4345682
NCBI-ProteinID: XP_015648249
UniProt: B9G150
LinkDB
Position
8:21410543..21417267
AA seq 601 aa
MAAATRAATASAARQVTKRNFAEAVQDLAAHVEACDYVAIAAQRTGAPTGWRRALPVDTP
ETAYLKAKLAAESFQPLHFAICPFRVDATSPSTLVAYPYNFHLFPRDELQLGMPAYSFSC
QSSYLSSMAHSGFDFNMCIYDGISYLSRAQESLARERIFIPHVRQLSSSPSTSIADSVFL
TRIKSRIEHWRKGYTKPCKTADGSLVNTLRQLILGSESYGSRPSFSIDVCSDRQVQLVLE
AANHISDDLVPLVVPDKAGTARAVRVIFTSSPEDKNLLLMDIKKMEDEHNLKFRGFREVI
DLLSSSQKPIISYNFLNDFTMIHSKFVAPLPPNLHEFMCSLRMVFSNVIDISHMWREIGP
LRKAKNIQGALSYLQRQYFVPMDVEIPQQDGNNSVTKSGENVLRITKLFAKLSNLLKISP
NGQTHSGDKCHTVEEYSYILYPSCTAEESEDDKSSNESNTTRSVRTDNVVFLWGFRETSV
KELRSRLASLHHAFSKDFELRLLDNSCSALIFHSSDTAIDLLREINSESPSLNNFFSEGL
KAAGFDAYRKVCRSGLWDSDLAEALDGVSSEPSTSTLSGRGTSEICWNTSLMLDLKEYLE
R
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcggcggccacgcgcgccgcgacggcgtcggcggcgaggcaggtgacgaagcggaac
ttcgcggaggccgtgcaggatctggcggcccacgtggaggcgtgcgactacgtggccatc
gcggcgcagaggacgggcgccccgacgggctggcggcgcgcgctgccggtggacaccccg
gagacggcgtacctgaaggctaagctcgccgcggagtccttccagccgctccacttcgcc
atctgccccttccgcgttgatgccacatccccttcgaccctcgtcgcctatccgtacaat
tttcatttatttcccagagatgagttacagttgggaatgcctgcttacagtttttcctgt
caatcatcttatttatcatctatggctcatagtggttttgatttcaatatgtgcatttat
gatggtatatcttatttatcaagggctcaagaatccttggcaagggaaaggatatttatc
cctcatgttcgccaattatcatcgtcaccaagcacatccattgctgattccgtttttctg
actagaattaaatcgagaatagagcattggcgaaaaggatatacaaaaccatgtaaaaca
gctgatggttctctagtaaatacccttaggcaactgattttgggtagtgaatcgtatggt
tcaaggcccagtttcagcattgatgtttgcagtgatcgccaagttcaactggttttggag
gcagcaaatcatatctctgatgaccttgtacctcttgttgttccggacaaagctgggaca
gctagggcagtgcgtgtgatcttcactagttctccagaggataagaaccttctcctgatg
gacataaaaaaaatggaggatgaacataatttgaagttccgtggttttcgagaagttatt
gatctactatcatcttcacagaaaccaattatatcttataatttcttgaatgatttcaca
atgatacactccaaatttgttgcacctcttccaccaaacttgcatgaattcatgtgctcc
ttgaggatggtattttctaatgttattgacatcagtcacatgtggagagaaattggccct
ttgagaaaagcgaagaatatacaaggtgctctgagttacctacaaagacaatactttgtg
ccgatggatgtagaaatacctcagcaagatggtaacaacagtgtcaccaaaagtggggaa
aatgttctgagaataacaaagttgtttgctaaactaagtaatttactgaaaatcagtccc
aatggtcaaactcactctggtgataagtgtcacacagttgaggaatattcttacatattg
tatccgagttgtacggctgaagaatctgaagatgataaatccagtaatgagtcaaatacc
accagatcagtgagaactgataatgttgttttcctatgggggtttagggagacatctgtc
aaagaactgagatctcgccttgcaagcttgcatcatgccttctcaaaagattttgagctc
agattattggataactcgtgctcagctttgatattccacagttctgatacggcaatagat
ttactaagagaaataaactcggaaagtccctctctgaataatttcttttcggaaggcctg
aaagctgcaggctttgatgcctacaggaaggtttgcaggtcagggctttgggattcagat
ttagctgaggccctggatggtgtttcatctgaaccatctacttcaacgctttctgggcgt
ggcacctctgagatatgctggaatacttcgctgatgctagatctaaaggaatatctggaa
cgctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268289
Entry
9268289           CDS       T01015                                 
Name
(RefSeq) poly(A)-specific ribonuclease PARN
  KO
K01148  poly(A)-specific ribonuclease [EC:3.1.13.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    9268289
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    9268289
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     9268289
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     9268289
SSDB
Motif
Pfam: CAF1 Rubis-subs-bind
Other DBs
NCBI-GeneID: 9268289
NCBI-ProteinID: XP_015636518
LinkDB
Position
4:complement(23356993..23361839)
AA seq 727 aa
MQRRRHPLLLLPRRRPPSRTLLSRLLSSSPPASGGGGGGGGGGVAVKQVTRGNLAEALEE
LRARVRGAAFVGIDLEMSGVTSAPWRDTLGLDRADVRYLKLRDSAERFAALQLGVCPFRW
DPAKSAFVAHPHNFFIFSRNEPLNDCSTHEFLCQTTSIDFLAKYQFDFNTCFREGIYYLS
RTQEEEALQKLYTLHNNETSAYPNTSEEEEDAPLKSAADVLFTERMKIKFNEWRNSIVSN
QRVDDHRSENFKFADQFQTVFFKMRPAIMLNGFTSHQLKLIRQILRTHFRDLVYVCTFLE
DGVSEKRVVYTDTNEDKISLMKNVREDLLKSREAKVKSAVGIRHVIDLLASERKLIVGHS
CFLDIAQIYSKFVGPLPSSMEEFALSINRMFPHMADTRHLMSVNDAVQYRMRHKSKSLSS
AFSLLCPALHAPDEKSSTLPSVRIEVEADETVLSCFTSGAKHEAGYDAFMTGCVFVQLCA
YHGIKFEQLSPLEDLATNINLKKHINLLPPCWNSGTVLDLSTGTERPDAGYKRRYPAAVY
DNVILIWGFQSKVRPKDIKDCICKVFGRASVTSVFPIDSTAVLVQFSKQESVNDFLDLKA
TLESADSAISVLHPLSTILEGGKTRAAKYDTYRDICRSSVSKFSFADQAEAVCSTSNSES
KFKECNAADGSGAYGSALDGTVPASVQQSGGAKSGSKNKGDDDFSYQDILDALQDGKTSV
GKRMSNA
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgcagcgccgccgccaccccctcctcctcctcccccgccgccgcccgccgtccagaacc
ctactctcccgcctgctctcctcctcgccgcccgccagcggcggcggcggcggcggggga
ggaggaggggtggcggtgaagcaggtgacgcgggggaacctggcggaggcgctggaggag
ctccgcgcgcgggtgcggggcgcggcgttcgtggggatcgacctggagatgagcggcgtg
acgagcgcgccgtggagggacaccctcggactcgaccgcgccgacgtccgctacctcaag
ctccgcgactccgcggagcggttcgcggccctgcagctcggcgtctgccccttccgctgg
gaccccgccaagtccgccttcgtcgcccacccgcataacttctttatcttttctcggaat
gagcccctgaatgattgttcaacacatgaatttctgtgtcagaccacatcgattgacttc
cttgcaaagtaccagtttgatttcaacacatgcttccgtgaaggaatatattatttatcc
agaacacaagaagaagaggcacttcagaaattatatacattgcataataatgaaacatct
gcatatccaaacacttccgaggaggaagaagatgcgccattaaagagtgctgcggatgtt
cttttcacagaaagaatgaagatcaaattcaatgagtggcgcaattcaatagtcagcaat
caaagagtcgatgaccataggtcagaaaacttcaaattcgcagaccagttccagactgtt
ttcttcaaaatgcgtcctgctatcatgcttaatggattcacgtcacatcagttaaagtta
atccgacagattttaagaacacattttagggaccttgtgtatgtgtgtacatttttggag
gatggcgtatcagagaagagagtagtttatacagacaccaatgaagacaagatatccttg
atgaaaaatgttcgggaagatctactaaaaagcagggaagcaaaagtcaaatcagcagta
gggatccgtcatgtcattgatcttcttgcctcagaaaggaaattgattgttggtcatagt
tgtttcctagatattgcacaaatctacagcaaatttgttggtcctcttccttcatccatg
gaggaatttgccttgagtatcaacagaatgttcccacatatggcagataccaggcatctt
atgtctgttaatgacgcggttcagtatcgtatgaggcacaaaagcaaatcactttcgtca
gccttttcattgttgtgccctgcacttcatgcacctgatgagaagtcatccacccttcct
tctgtgagaattgaagtcgaggcagatgaaacagtgttatcttgcttcacttcaggtgct
aagcatgaagcaggttatgatgcattcatgactggatgtgtttttgttcagctctgtgct
tatcatggcattaaatttgagcaactctctcccctggaggacctagcaacaaacattaat
ctgaagaaacacatcaatctgctgcccccatgctggaacagtggaacagtgcttgatttg
agtactggcacggagagaccagatgcaggttataagcgtagatatcctgctgccgtgtat
gacaacgtcattcttatctggggattccagtctaaggtgagaccaaaggatataaaggac
tgcatctgcaaagtgtttggtcgagcttctgttacatcagtcttcccgattgattccact
gcggttcttgttcaattcagcaaacaagagtctgtaaacgatttcttggatctgaaggct
accttagagagtgcagatagtgctatttcagtcttgcaccctttgtcaactatactggaa
ggaggcaaaacacgagcggcaaaatatgatacctacagagatatttgccgctcctctgta
tcaaagttctccttcgcggatcaagctgaagcggtttgttcaacttcaaacagcgagtcc
aagttcaaggagtgcaatgctgctgatggatccggagcatacgggagtgctcttgatgga
actgtgcctgcctcggtgcagcagtcaggaggagcgaagtctggctccaagaataaaggc
gacgatgatttttcataccaggatatcttagatgcgctacaggatggcaaaacatcagtt
ggcaaacgaatgagtaacgcatga

DBGET integrated database retrieval system