KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336286
Entry
4336286           CDS       T01015                                 
Name
(RefSeq) 6,7-dimethyl-8-ribityllumazine synthase, chloroplastic
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4336286
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     4336286
SSDB
Motif
Pfam: DMRL_synthase
Other DBs
NCBI-GeneID: 4336286
NCBI-ProteinID: XP_015637168
UniProt: Q7XUK6 Q0JC17
LinkDB
Position
4:complement(24878152..24881725)
AA seq 221 aa
MAAAAPATTSSAAARPSSSSSSSRQSDAPLRAATVSFPYSPRPAALAAGARASRVSPVVV
AAGGGHQRLMGSLTNTQGLRFGVVVARFNEIVTNLLLQGALETFERYSVKKENITVVSVP
GSFEIPVAAQKLGKSGKFDAILCIGAVIRGDTTHYDAVANSAASGVLSAGLSAEIPCIFG
VLTCDDMDQALNRAGGKAGNKGAEAALTAIEMASLFQHHLA
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcggcggctgcccccgcgacgacgtcatccgcggccgcgaggccctcctcctcctcc
tcctcctcgcggcaatccgacgctcctctgcgcgccgccaccgtctccttcccttactcc
ccacggccggccgcgttggctgcaggcgctcgggcctcgcgggttagccccgtcgtggtc
gccgccggcggcgggcaccagcggcttatggggtcgttgactaacacccaggggctcagg
tttggagtggttgtggcacggttcaatgagattgtcaccaacttgctactgcagggagct
cttgagacatttgagagatattccgtcaaaaaagaaaatataacagttgtaagtgttcct
ggcagttttgaaattcctgttgcggcacaaaagcttgggaagtctggaaagtttgatgca
attttgtgcattggcgctgtgattagaggtgacacaacccactacgatgctgttgcaaac
tctgctgcttcaggtgtactgtctgctggattgtctgctgagatcccatgcatatttggt
gttctgacatgtgatgacatggaccaggctctaaatcgtgctggtggtaaggctggaaac
aagggagctgaagccgctctaactgcaatcgagatggcctcgctgttccagcatcacctg
gcctga

DBGET integrated database retrieval system