KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336633
Entry
4336633           CDS       T01015                                 
Name
(RefSeq) phosphorylated carbohydrates phosphatase TM_1254
  KO
K22912  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.104]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4336633
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     4336633
SSDB
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase HAD
Other DBs
NCBI-GeneID: 4336633
NCBI-ProteinID: XP_015634163
UniProt: A0A0N7KJH6 Q7XTZ9
LinkDB
Position
4:27868029..27870371
AA seq 350 aa
MIFSVSLFGSSHQSIHKLYRKCWSSNSHSTLNVLSLAKTVGQSMRMKRIRVKPHATDLKN
RPQAHEDNVFYKLVYRLPENLSWLLASPEMARRPPSKKKLKKEEMVSSNQFGVILEWEGV
VVEDDDPDLEPRVWYVLSLEEAKSFPPDAVLKEIEGMRTDQAILEVLHWSEDPQEVQRLA
ARKEVIYKTLRGRFYQLRPGVLDFLNTLVDFDIPIAITTPRPRLSLEEGIKAVGLQGYFD
AIVAAEDFCRGKPEGEMFEVTAGQLGLEPDVCLVLGNSNSTIESAHTAGMRCVAVASRYP
AYELQAANHVVRWLDQLSVADLQRIANGEILGLRGRRSDMDMDMEIVIEE
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgatattttcagtcagcttatttggtagttcccaccagtccattcacaaactttacagg
aaatgctggtcaagtaactcacattctacactgaatgtgctttcacttgcaaaaactgtg
ggtcaaagtatgagaatgaagaggatacgtgtcaagcctcatgccactgacctgaagaat
cgcccccaggcccatgaggataatgtgttctacaaattggtttataggctccctgaaaac
ctcagctggctgttggcgtcaccagaaatggctagaagaccaccctcaaagaagaaacta
aagaaggaagaaatggtaagtagtaatcaatttggtgtgatcttggagtgggaaggagtt
gttgtggaagatgatgatccagatttggagcctcgagtttggtacgtgttatcacttgaa
gaggcaaagtcttttcctccagatgcagtgctgaaggaaattgaggggatgaggactgat
caggctattttagaagtcttacattggtcagaagatccacaagaagtacaaaggctggca
gcacgcaaggaggtaatatataaaacattacgtggtagattctaccaactgcgaccaggt
gttcttgatttcctgaacacccttgtggattttgacattccaatagcaatcacaactcct
cgcccacggttgagcctagaagaagggataaaagctgttggtcttcaaggctactttgat
gctatagtggcagcagaggatttctgccgagggaaacccgagggggagatgtttgaggtc
acagcagggcaacttggtcttgagcctgatgtttgtcttgtgctgggtaactcaaattcg
acaatagaatctgcgcatactgctgggatgaggtgtgttgcggttgcaagccgataccct
gcctatgagctccaagcagcaaaccatgttgtaagatggcttgatcagctatctgtcgct
gacctgcaaaggattgccaatggcgagattcttgggctcaggggcagaagatctgacatg
gacatggacatggagattgtgatcgaggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347902
Entry
4347902           CDS       T01015                                 
Name
(RefSeq) sugar phosphatase YfbT
  KO
K22912  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.104]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    4347902
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     4347902
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Other DBs
NCBI-GeneID: 4347902
NCBI-ProteinID: XP_015611666
UniProt: Q652P6 A3C1P0
LinkDB
Position
9:22707628..22709557
AA seq 383 aa
MMVVDTVSASTSLVAHHLFDQRSKANHHLRRTLHVVSCRPLPTHFAGRRLVARAPRQHQP
RLADWTVKALAMGVTKEASPHREYRGIPGEGADMGDIGITNPKTTWPPRNRADDPKLHNP
LLRLERMGCGWLGVIFEWEGVIVEDDAELERQAWFTLAQEEGKSPPLAFVLKRIEGMKSE
QAISEVLCWSRDPSELRRLSSRKEEIRCNLRGTAFYQMRNGSREFMSTLANYKIPLAVAT
TRPRKVIEEAIDAVGVRSFFDAVVAAEDVYRGKPDPEMFLYAAQLLSFIPERCIVFGNSN
SAVEAAHDARMKCVAVASKHPIYELNAADLVVKQLDELSVVDLKNLADIESPEFGMEPEP
EMEEEEDEDSSPSTSVGVDDLFW
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgatggtggttgatacggtcagcgccagcacctccctcgttgcccaccacctgttcgac
caaaggtccaaggcaaaccaccacctccgccggactctccatgtcgtctcctgccgcccc
ctgcccactcacttcgccggtcgccgccttgtggccagggcgcccaggcagcatcaacct
cgcctcgcggactggaccgtcaaggcgctcgccatgggggtcaccaaggaggccagccct
cacagggagtaccgggggatcccgggggaaggcgctgacatgggcgatattgggatcacc
aatcccaaaacgacgtggcctccacggaacagggccgatgatcccaagctgcacaacccg
ctgctccggcttgagcgcatgggctgtggttggctcggagtgatctttgagtgggaaggc
gtgattgttgaggatgacgctgaattggaaaggcaggcatggtttaccctcgcgcaagaa
gagggcaagtctccacccctggcgtttgtattgaagaggattgaaggaatgaaaagcgag
caagcgatatctgaggttctctgctggtctcgggacccatctgagttaaggagattgtcc
tcacggaaagaggagatacgctgcaacctacgtggaactgccttttatcaaatgaggaat
ggttcgagggagtttatgagcacgcttgccaactataagatccctcttgccgtggccacc
acgcggccaaggaaggttatcgaagaagcaattgacgctgttggcgtgcgaagcttcttt
gatgcagttgtggcagcagaggatgtgtaccgggggaagcctgaccctgaaatgtttctc
tatgcagcgcagctcctgagtttcatccctgagaggtgcatcgtttttggtaactccaat
tcagcagtggaggctgcacatgatgccagaatgaagtgtgtggctgttgcaagcaagcac
ccgatctacgagcttaatgccgcggaccttgtggtgaagcagcttgatgagctctctgtg
gttgacctgaagaaccttgctgacattgagtctccagagtttggcatggagcctgagcca
gagatggaggaggaggaggacgaagattcgtccccgtcaacttcagttggtgtagatgat
ttgttctggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268251
Entry
9268251           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC9268251 isoform X1
  KO
K20860  FMN hydrolase / 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase [EC:3.1.3.102 3.1.3.104]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00740  Riboflavin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    9268251
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.102  FMN hydrolase
     9268251
    3.1.3.104  5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase
     9268251
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Other DBs
NCBI-GeneID: 9268251
NCBI-ProteinID: XP_015615408
LinkDB
Position
11:11202369..11206742
AA seq 262 aa
MVSLLPRAPCLASSIPKPTALRPPCMASTSAAAPAAAAATAEASASRPPRKLPVLLFDVM
DTVVRDPFYHHIPAFFQMSMKELLENKHPTAWSEFEMGLIDENELAKKFFNDGRSFDLEG
EKIRSGLKACMVRAYEYIDGVEDILYSLKQNNYEVHAFTNYPVWYQLVEEKLKLSKYLSW
TFCSCTVGKRKPSPDFYLHAVDHLNVDPASCIFIDDRMTNIEAALSVGMVGLQFKNAEVL
KKDLCSLGVEFAPVHEGEIQVQ
NT seq 789 nt   +upstreamnt  +downstreamnt
atggtctccttgctcccccgcgcgccctgcctcgcctcctccatccccaagcccaccgcc
cttcggccgccgtgcatggcgtccacatccgccgcggcccctgccgctgcagcggcgacg
gcggaggcgtccgcgtcccggccgccgaggaagctgccggtgctgctgttcgacgtcatg
gacaccgtcgtccgcgaccccttctaccaccacataccggccttcttccaaatgtcaatg
aaggaactcctcgaaaacaagcatccaacagcatggtctgaatttgagatgggtctaatt
gatgagaatgaactggccaaaaagttcttcaatgatggcaggtcttttgatttggaaggt
gagaagatcagatcaggtttgaaagcatgcatggtgagggcatatgagtacatcgatggt
gttgaagacattctttacagtttgaagcaaaataactatgaagtgcatgcatttacaaat
tatccagtgtggtaccagttagttgaggagaagttaaagctctcaaagtatttgtcctgg
acattctgttcatgcacagttggtaagcgcaaaccttcgcctgatttttatctacatgct
gtggaccacctaaacgttgatccagcaagctgcatattcattgatgacaggatgacaaac
attgaagcagcccttagtgtaggaatggttggtttgcaatttaaaaatgctgaggtgctc
aagaaggatttatgctcgcttggagttgaatttgcacctgtgcatgaaggtgaaatacaa
gtccaataa

DBGET integrated database retrieval system