KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336725
Entry
4336725           CDS       T01015                                 
Name
(RefSeq) protein HOTHEAD
  KO
K00108  choline dehydrogenase [EC:1.1.99.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
Module
osa_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4336725
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.1  choline dehydrogenase
     4336725
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO NAD_binding_8 FAD_binding_2 Lycopene_cycl Pyr_redox_2 FAD_binding_3
Other DBs
NCBI-GeneID: 4336725
NCBI-ProteinID: XP_015635193
UniProt: A3AWL0 Q7XTZ0
LinkDB
Position
4:28870316..28872728
AA seq 591 aa
MASDMDTTRALAILAATSFVAMLACVQAAGDESYTFMKDAVQSPQVSYYDYIIVGGGTAG
CPLAATLSQRFRVLLLERGGSPYDDERIGNMTRFADTLSDTSPSSPAQRFVSEDGVINSR
PRVLGGGSCINAGFYTRASDEYVRGLGWDLEATTAAYRWVEDVVAFQPELGPWQSALERG
LLEAGIAPQNGFTFDHLGGTKVGGSIFDAEGRRHTAADLLRYARTDGIDVLLRARVAKIL
FNVRAGRRPVAHGVVFHDSEGQMHRAYLSNGRGNEIILSAGAMGSPQLLMLSGVGPADHL
RSFGITLVLNQPAVGQGMSDNPMNAIYVPSPSPVEVSLIQVVGITEVGSYIEGASGANWG
VRRSGSGGDRPHRNFGMFSPQTGQLATVPPKQRTPEAIARAAEAMSQLDDTAFRGGFILE
KILGPLSTGHLELRNRNPDDNPSVTFNYFAHPEDLRRCVAGVSVIERVIRSEAFANFTYP
YFSVETLLNMTAGFPVNLRPRHDNDSTSLEQFCKDTVMTIWHYHGGCQVNRVVDAEYRVI
GVDALRVIDGSTFNASPGTNPQATVMMLGRYMGVKIQNERLGNEGLGRRNL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggcgtccgacatggacaccacacgagcgctggccatcttagcggccacaagctttgtt
gcaatgctagcatgtgtacaggcggcaggagacgagagctacacgttcatgaaggacgcg
gtgcagtccccgcaggtgtcgtactacgactacatcatcgtgggcggcggcacggccggg
tgcccgctcgcggcgacgctgtcgcagcgcttccgcgtgctcctgcttgagcgcggcggc
tcgccgtacgacgacgagcggatcgggaacatgacacgcttcgcggacacgctgtccgac
acgtccccctcgtcgcccgcgcagcggttcgtgtccgaggacggcgtgatcaactcgcgc
ccgcgggtgctgggcggcggcagctgcatcaacgccgggttctacacgcgcgccagcgac
gagtacgtgcgtggactcgggtgggacctcgaggcgaccacggcggcgtaccggtgggtg
gaggacgtggtggcgttccagccggagctgggtccctggcagtcggcgctggagagaggg
ttgctggaggccgggatcgcgccgcagaacggcttcacgttcgaccacctcggcgggacg
aaggtcggcggctcgatcttcgacgccgaggggcggcgccacacggccgccgacctgctc
cggtacgcccgcaccgacggcatcgacgtgctgctccgagccagagtggccaagatcctg
ttcaacgtcagagctggaagacggccagtggcgcacggggtggtgttccacgattccgag
gggcagatgcacagggcttacctcagcaacggccgtggcaacgagatcatcctctcggcg
ggcgccatgggcagcccgcagttgctgatgctcagcggcgtcggccccgccgaccacctc
cgctcgttcggcatcacgctcgtcctcaaccagccggccgtcggccagggcatgtccgac
aaccccatgaacgccatctacgtgccgtcgccttccccggtcgaggtgtcgctcatccag
gtggtcggcatcactgaggtcgggagctacatcgagggcgccagcggcgccaactggggc
gtccggcgctccggctccggcggcgacagaccgcaccgcaacttcggcatgttctctcca
cagacggggcagctggccacggtgccaccgaagcagcggacgccggaggccatcgcgcgc
gcggcggaggcgatgagccagctcgacgacacggcgttccgcggcggcttcatcctggag
aagatcctcggcccgctgtccacgggccacctcgagctgcgcaaccgcaaccccgacgac
aacccgtcggtgacgttcaactacttcgcgcacccggaggacctccggcgctgcgtggcc
ggcgtgtcggtgatcgagcgcgtcatcaggtccgaggccttcgccaacttcacgtacccg
tacttctccgtcgagacgctgctcaatatgacggcggggttccccgtcaacctccggcca
cggcacgacaacgactccacgtcgctggagcaattctgcaaggacaccgtcatgaccatc
tggcactaccacggcggctgccaggtgaacagggtcgtcgacgccgagtaccgcgtgatc
ggcgtcgacgcgctgcgcgtcatcgacggctccacgttcaacgcctcgccgggaaccaat
ccgcaggccactgtcatgatgctcggcaggtacatgggagtcaaaatccaaaacgagagg
ttgggaaatgaaggattaggaaggagaaatctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272377
Entry
9272377           CDS       T01015                                 
Name
(RefSeq) choline monooxygenase, chloroplastic isoform X1
  KO
K00499  choline monooxygenase [EC:1.14.15.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
Module
osa_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    9272377
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.7  choline monooxygenase
     9272377
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske VanA_C
Other DBs
NCBI-GeneID: 9272377
NCBI-ProteinID: XP_015643168
LinkDB
Position
6:29347818..29353381
AA seq 411 aa
MAIAQSAAAVSSAARASRPRPTRAAPRRIAASASSVAPPEPAARRLVAAFDPAVPLASAV
TPPSGWYTDPDFLRLELDRVFLRGWQAVGHIWQVKNPNDYFTGSRLGNVEFVICRDANGE
LHAFHNVCRHHASLLACGSGQKTCFQCPYHGWTYGLDGVLLKATQISGIKNFNKNDFGLI
PIKVATWGPFVLAKFDSGFSQETADNTVGDEWLGSASDLLSRNGIDTSLPHICRREYIIE
CNWKVFCDNYLDGGYHVPYAHGTLASGLQLQSYETHTYERVSVQRCESVQAEQNDFDRLG
TKAIYAFVYPNFMINRYGPWMDTNLVVPLDATRCKVIFDYFLDKSLMDDQNFIESSLKDS
EQVQMEDIALCEGVQRGLESPAYSVGRYAPSVEMAMHHFHCLLHANLSGDW
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcgatcgcgcaatccgcggccgcggtatcatccgccgcaagagcctcccgcccaagg
ccgacccgcgccgcgccgcgccgcatcgccgcctccgcctcctccgtggcgccgccggag
cccgccgcgcggcgcctcgtggcggcgttcgacccggcggtcccgctggcctccgccgtg
acgccgccgagcgggtggtacaccgacccggactttctccggctcgagctcgaccgcgtc
ttcctccgcgggtggcaggctgttggccacatatggcaagtcaagaacccaaatgactac
ttcacaggaagtagacttggaaatgtagaatttgtcatatgtcgggatgcaaatggagaa
ctccatgcttttcacaacgtgtgtcgccatcacgcctcactccttgcatgtggaagtggt
cagaagacttgcttccagtgcccttatcatggctggacatatggactggatggagtcctc
ctaaaagccacacaaatatcaggaatcaagaacttcaacaaaaatgattttggtctcatt
cctattaaagtggctacatgggggccttttgtattggccaaatttgatagtggtttctct
caagaaactgctgataacacagttggagatgaatggctgggtagtgcttcggatctgctg
agtagaaatggcattgacacctcgttgcctcatatttgcaggcgagaatatataattgaa
tgtaattggaaggtcttttgtgacaactatctggatggtggctatcatgttccatatgcg
catggaaccctagcatctggtctacagcttcaatcctacgaaacacatacatatgaaaga
gttagtgttcaaaggtgtgaaagtgtccaagcagaacaaaatgatttcgatcgcttaggg
acaaaagctatctatgcttttgtttatccaaactttatgattaacaggtatggtccatgg
atggacactaatctagtggtcccattggatgcaaccagatgtaaagtgatatttgattat
ttccttgacaagtctcttatggacgaccagaattttattgagagcagcttaaaagacagc
gaacaagtacagatggaagacattgcactttgcgaaggagttcagcggggcctggaatca
ccagcctacagtgtgggaagatatgcaccatcagtggagatggccatgcaccacttccac
tgcctcttacatgccaatcttagtggtgactggtga

DBGET integrated database retrieval system