KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336740
Entry
4336740           CDS       T01015                                 
Name
(RefSeq) polyprenol reductase 1
  KO
K12345  3-oxo-5-alpha-steroid 4-dehydrogenase 3 / polyprenol reductase [EC:1.3.1.22 1.3.1.94]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4336740
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     4336740
    1.3.1.94  polyprenol reductase
     4336740
SSDB
Motif
Pfam: Steroid_dh
Other DBs
NCBI-GeneID: 4336740
NCBI-ProteinID: XP_015633510
UniProt: Q7XUH5
LinkDB
Position
4:29071784..29076273
AA seq 354 aa
METEGWPALQPLLCLAWIATTLPIIVAALPIPAAAGGHLLRRLLSAFSSRGKTVRPSPAS
SSGSSSSKAKFTVPQKYFMHFYVVGVLATTILLLAIWFYAYMKMTPLLPESSSYSTIASH
LVGSNSFSFGRVHSRTMGHKYHVWRTVFVLLLMEIQVLRRLYETEHVFHYSPSARMHIVG
YLTGLFYYVAAPLSLASSCIPEAAEYLQGQVAEFIVKGRARMPDLVIDSSSLLQPLLKLG
WTQWIGAVIFIWGSLHQIRCHAILGTLREHKDSDEYVIPCGDWFNRVSCPHYLAELVIYF
GMLVASGGEDIPVWFLFVFVITNLSFAAVETHKWYLQKFEDYPRSRYAIIPFVC
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggagaccgagggctggcctgccctccagcctctgctgtgcctcgcctggatcgccact
acactccccatcattgtcgccgcgctgccaatccccgcagctgctggtggtcacctcctt
cgccggctgctctcggccttctcctcccgcggcaagaccgtgaggccctcccccgcctca
tcctctggttcctcctcttctaaggcgaagttcactgttccacaaaaatacttcatgcat
ttttatgtggtcggagtgctggcaacaacaattttgcttctggcaatatggttctatgca
tatatgaaaatgacaccattattgcctgagtcatcaagttattccacaattgccagccat
cttgtaggctcaaattcattctcttttggtcgtgttcactcgcgcaccatgggacacaag
tatcatgtctggcgaacagtatttgtacttctattgatggaaattcaagtgctgagacga
ctatatgagactgaacatgtgttccactacagcccttctgctcggatgcatattgtagga
tatttgacgggtctattctattatgtagctgcaccattatctcttgctagctcttgtatc
cctgaagcagcagagtatcttcaaggtcaagtagctgagttcatagtaaagggtcgtgcg
agaatgccagatcttgtaattgattcatcatctctactacagcctcttctgaagttgggg
tggacccagtggataggtgctgttatattcatttggggttccctccatcagatccgttgc
catgcaattcttggaacgttgcgtgagcacaaagattctgatgaatatgtaattccttgt
ggtgactggtttaatcgagtctcttgccctcattaccttgctgaactagtaatatatttt
ggcatgttggttgctagtggtggagaagacattccagtgtggttcctgttcgtatttgtg
atcacaaacctgtcatttgcagcagtagaaactcacaagtggtatcttcaaaagtttgaa
gactatcctcgctctcgctatgccatcattccatttgtatgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343281
Entry
4343281           CDS       T01015                                 
Name
(RefSeq) polyprenol reductase 2
  KO
K12345  3-oxo-5-alpha-steroid 4-dehydrogenase 3 / polyprenol reductase [EC:1.3.1.22 1.3.1.94]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4343281
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     4343281
    1.3.1.94  polyprenol reductase
     4343281
SSDB
Motif
Pfam: Steroid_dh
Other DBs
NCBI-GeneID: 4343281
NCBI-ProteinID: XP_015646164
UniProt: Q7F0Q2
LinkDB
Position
7:18427792..18431436
AA seq 353 aa
MESEGWPALQPLLCFAWIAATLPIIAAALPIPTAVGGHLLRRLLSAFSSRGKTVRPSPAS
SSGSSSSKAKFTVPQKYFMHFYVVGVLATTILLLAIWFYAYMKLTPLLLESSSYSTIFSH
LVGSNSFSFGRVRSRTMGHKYRVWRTVFALLLMEVQVLRRLYETEHVFHYSPARMHIVGY
LTGLFYYVAAPLSLASSCIPEAAEYFQGQVPEFVVKGRARMPDLVIDSSSLLQPLLKLGW
TQWIGAVIFIWGSLHQIRCHAILGSLREHKDYDEYVIPCGDCFNRVSCPHYLAELVIYFG
MLVASGAEDIPVWFLFIFVITNLSFAAVETYNWYLQKFEDYPRSRYAIIPFVC
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagagcgagggctggcctgccctccagcctctgctgtgcttcgcctggatcgccgcc
acactccccatcattgccgctgcgctgccaatccccacggccgttggaggtcacctcctt
cgccggctgctctcggccttctcctcccgcggcaagaccgtgaggccctcccccgcctca
tcctctggttcctcctcttctaaggcgaagttcactgttccacaaaaatacttcatgcat
ttttatgtggtcggagtgctggcgacaacaattttgcttctggcaatatggttctatgca
tatatgaaattgacaccattattgcttgagtcatcaagttattccacaattttcagtcat
cttgtaggctcaaattcattctcttttggtcgtgttcgctcgcgcaccatgggacacaag
tatcgtgtctggcgaacagtatttgcacttctattgatggaagttcaagtgctgagacga
ctatatgagactgaacatgtgttccactacagtcctgctcggatgcatattgtaggatat
ttgacaggtctattctactatgtagctgcaccattatctctcgctagctcttgtattcct
gaagcagcagagtattttcaaggtcaagtacctgagttcgtagtaaagggtcgtgcgaga
atgccagatctagtaattgattcatcatctctactacagcctcttctaaagttggggtgg
acccagtggataggtgctgttatattcatttggggttccctccatcagatccgttgccat
gcaattcttggatcgttgcgtgaacacaaagattatgatgaatatgtaattccttgtggt
gactgctttaatcgggtctcttgtcctcattaccttgctgaactagtaatatattttggc
atgttggttgctagtggtgcagaagacattccagtgtggttcctgttcatatttgtgatc
acgaacctgtcatttgcagcagtagaaacttacaattggtatcttcaaaagtttgaagac
tatcctcgctctcgctatgctatcattccatttgtatgctag

DBGET integrated database retrieval system