KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336894
Entry
4336894           CDS       T01015                                 
Name
(RefSeq) probable protein-S-isoprenylcysteine O-methyltransferase
  KO
K00587  protein-S-isoprenylcysteine O-methyltransferase [EC:2.1.1.100]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4336894
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.100  protein-S-isoprenylcysteine O-methyltransferase
     4336894
SSDB
Motif
Pfam: ICMT PEMT DUF1295 NnrU
Other DBs
NCBI-GeneID: 4336894
NCBI-ProteinID: XP_015636909
LinkDB
Position
4:30428176..30431743
AA seq 238 aa
MRHLPLPPAAAAAAAAPREASPPPPPPPAARALSPTAVAFAQIPSVAMAARAQAWLFAAA
LVIFHGSEYVLAAAFHGRRNVTATSLLISKQYVLAMSFAMLEHLTEALLFPELKEYWFVS
YVGLVMVIIGEVIRKLAVVTAGRSFTHVIRIHYEDQHKLITHGVYRLMRHPGYSGFLIWA
VGTQVMLCNPLSTVAFTLVLWRFFSKRIPYEEFFLRQFFGREYEEYAQKVHSGLPFIE
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcggcatctgcctctgcccccagcagcagcagcagcagccgccgcgccgcgcgaagca
tctcctcctcctcctcctcctcccgccgcgcgagcgctgagccctactgctgtcgccttt
gcccagatcccgtcggtggccatggcggcgagggcgcaggcgtggctgttcgcggccgcg
ctggtcatcttccacggctccgagtacgtcctcgccgcggccttccacggccgccgcaac
gtcaccgccacatcacttcttatcagcaagcagtatgttttggcaatgagttttgcaatg
ttggaacacctgacagaagctcttctcttccctgaattgaaggagtattggtttgtcagt
tatgttggtttagtaatggtgattattggtgaagttattcgtaaacttgctgtggtgaca
gctgggcgttcctttacgcatgttataagaattcactatgaagaccaacataagctgatt
actcatggggtgtataggcttatgcgtcatcctgggtattctggctttcttatatgggca
gtaggaacccaggttatgttgtgtaatccattatccacagttgcattcacattggtgctg
tggcgattcttttcaaaacggataccgtatgaagaatttttcttaaggcagttctttggt
cgtgaatacgaagaatacgcacagaaagtgcactcaggattaccttttatagaatga

DBGET integrated database retrieval system