KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336914
Entry
4336914           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L7-3
  KO
K02937  large subunit ribosomal protein L7e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4336914
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4336914
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4336914
SSDB
Motif
Pfam: Ribosomal_L30_N Ribosomal_L30
Other DBs
NCBI-GeneID: 4336914
NCBI-ProteinID: XP_015637188
UniProt: Q0JAC6 B9FCC7
LinkDB
Position
4:30599899..30602290
AA seq 244 aa
MASEAAKVVVPESVLRKRKREEVWAAASKEKAVAEKKKSIESRKLIFSRAKQYAEEYEAQ
EKELVQLKREARMKGGFYVSPEEKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLK
VNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKLNKQRIPLTNNKVIEEGLGKHDI
ICIEDLVHEIMTVGPHFKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNRENYINELI
RRMN
NT seq 735 nt   +upstreamnt  +downstreamnt
atggcgtccgaggcggccaaggtggtggtgccggagtccgtgctccgcaagaggaagcgg
gaggaggtgtgggcggccgcgagcaaggagaaggccgtcgccgagaagaagaagtccatc
gagagccgcaagctcatcttctcccgcgccaagcagtacgccgaggagtacgaggcccag
gagaaggagctggtgcaacttaagcgtgaggctcggatgaagggtggtttctatgtcagc
cctgaggaaaagttgctgtttgtggtccgtatccgtggtatcaatgccatgcacccgaag
accaggaagattttgcagctcttgcgtttgaggcagatctttaatggagtgttcttgaag
gtcaacaaagccaccattaacatgctgcgcagggttgagccatatgttgcatatgggtac
ccaaatttgaagagtgtccgtgaattgatctacaagaggggctatggaaagctcaacaag
caaagaatccctcttacaaacaacaaagtcatcgaggagggtttgggtaagcatgacatc
atctgcattgaggatcttgttcatgagatcatgactgttggcccacatttcaaggaggcc
aacaacttcctctggccattcaagctgaaggcaccactgggtgggctgaagaagaagagg
aaccactacgttgagggtggtgatgctggtaaccgtgagaactacatcaacgaactcatc
agaaggatgaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345009
Entry
4345009           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L7-3
  KO
K02937  large subunit ribosomal protein L7e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4345009
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4345009
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4345009
SSDB
Motif
Pfam: Ribosomal_L30_N Ribosomal_L30 DUF5427
Other DBs
NCBI-GeneID: 4345009
NCBI-ProteinID: XP_015650122
UniProt: Q0J741 Q6YYR2
LinkDB
Position
8:8153282..8155773
AA seq 245 aa
MAAEVAKAAVVPESVLKKRKREEQWAADRKEKALAEKKKAVESRKLIFARAKQYAQEYDA
QEKELVQLKREARMKGGFYVSPEAKLLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFL
KVNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKLNKQRIPLQNNKVIEEGLGKHD
IICIEDLVHEIMTVGPHFKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNREDYINEL
IRRMN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggcggcggaggtggcgaaggcggcggtggtgccggagtcggtgctgaagaagcggaag
cgggaggagcagtgggcggcggacaggaaggagaaggcgctcgccgagaagaagaaggcc
gtcgagagccgcaagctcatcttcgcccgcgccaagcagtacgcccaggagtacgacgcg
caggagaaggagcttgtgcagctcaagcgtgaggctcggatgaagggtgggttctacgtc
agccctgaggccaaacttctgtttgtggtccgcatccgtggtatcaatgccatgcacccc
aagaccaggaagatcttgcagcttctgcggttgaggcagatcttcaatggtgtcttcctc
aaggttaacaaggcaaccattaacatgctgcgcagggttgagccatatgttgcatatggg
tacccaaacctgaagagtgtcagggaattgatctacaagaggggttacggaaagctcaac
aagcagaggattcctcttcagaacaacaaagtcattgaggagggcttggggaagcatgac
atcatctgcattgaggatcttgtccacgagatcatgactgtcggtccacacttcaaggag
gccaacaacttcctgtggcccttcaagttgaaggcaccactcggtggcctcaagaagaag
aggaaccactatgtcgagggtggtgatgccggcaaccgtgaggactacatcaacgagctc
atccggaggatgaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346195
Entry
4346195           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L7-1
  KO
K02937  large subunit ribosomal protein L7e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4346195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4346195
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4346195
SSDB
Motif
Pfam: Ribosomal_L30_N Ribosomal_L30
Other DBs
NCBI-GeneID: 4346195
NCBI-ProteinID: XP_015650413
UniProt: Q6ZJG8 Q6ZIT2
LinkDB
Position
8:27127743..27129674
AA seq 248 aa
MMAEEGTQQLPYVRETVLKKRKVNEDWAVKNRERKAAKRQRRRDDGKGAIKRPEDFVREF
RNKELDFVRMKTRLKVRKLPPAETLNSKLVFAIRIPGTMDLHPHMRRILRKLRLTQVLTG
VFLKATDATMKRLLVVEPFITYGFPNLKNVKDLIYKKGRGFLDKEPFPLTSNDLIEKALG
EYGIICLEDLVHEIASVGPHFREASNFLMPFKLKCPERRLQMKKKPFKDGGDSGNREDKI
NELIEKLN
NT seq 747 nt   +upstreamnt  +downstreamnt
atgatggcggaggaggggacgcagcagctgccgtacgtgcgggagacggtgctgaagaag
cggaaggtgaacgaggactgggcggtcaagaaccgggagcggaaggcggccaagaggcag
cgccgccgcgacgacggcaagggcgccatcaagaggcccgaggacttcgtcagggagttc
cgcaacaaggagctcgacttcgtccggatgaagacccgcctcaaggtccgcaagctcccc
cccgccgagaccctcaactccaagctcgtcttcgcgattcgcatccctggcacaatggac
ttgcatccacacatgaggaggattttgcgcaagctgcggctgacgcaggtcctcaccggc
gtgttcctcaaggccactgacgctactatgaagaggcttcttgttgtggagccgtttatc
acttatgggttcccaaatttgaagaatgtgaaggatcttatttacaagaagggccgtggg
ttcctggacaaggaacctttccctcttaccagcaatgatctcattgagaaggctctggga
gaatatggcatcatatgtttggaagatcttgtgcatgaaatcgcatcagttggcccacac
ttcagagaagcttcaaatttcctcatgcccttcaagctcaagtgtccagagaggaggttg
cagatgaagaagaaacccttcaaggatggtggtgactcagggaaccgcgaagataaaatc
aatgaattaattgagaagttgaattag

DBGET integrated database retrieval system