KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336931
Entry
4336931           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: 26S proteasome non-ATPase regulatory subunit 1 homolog A
  KO
K03032  26S proteasome regulatory subunit N2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4336931
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4336931
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4336931
SSDB
Motif
Pfam: RPN2_C PC_rep HEAT_2
Other DBs
NCBI-GeneID: 4336931
NCBI-ProteinID: XP_015636210
LinkDB
Position
4:complement(30798916..30804811)
AA seq 1007 aa
MAAAAVATVSSASGILAMLQEPAEELKLHALASLNSVVHLFYPEISTSIPTIESLYEDED
FEQRQLAALVVSKVFYYLGELNDALSYALGAGPLFDISEDSDYAHALLAKALDEYARLKT
KAPKGTRRKKYVDPRLEAIVERMLEKCILDGKYQQAMGMAVECRRLDKLESAIVRCDNIH
GALSYCINLSHQYVNHREYRFEVLRCLVKIYQTLPHPDYLSICQCLMFLGEPETVANILD
KLLSGSKDDALLAYQIAFDLVENENQAFLLNVRNRLASQTPESNPDSGSALPDDQAANAG
TGSTEPAGDVQMRDDTATPNGSSHTVDPNEVARADRLAKIKGILSGETSIQLTLQFLYSH
NRSDLLILKTIKQAVEMRNSVCHSATICTNAIMHAGTTVDTFLRENLEWLSRATNWAKFS
ATAGLGVIHRGHLQQGRALMAPYLPQSGAVGGGSPYSEGGALYALGLIHANHGEGIKQFL
RESLRNTSAEVIQHGACLGLGLAALGTADEEIYEDIKNVLYTDSAVAGEAAGIGMGLLMV
GTASEKASEMLAYAHDTQHEKIIRGLSLGIALTVYGREEEADTLIEQMTRDQDPILRYGG
MYALALAYRGTANNKAIHQLLHFAVSDVSDDVRRTAVMALGFVLYNEPEQTPRIVSLLSE
SYNPHVRYGAALAVGISCAGSGLSDAISLLEPLTSDVVDFVRQGALIAMAMVMIQTNESF
DSRVGTFRRQLEKIILDKHEDTMSKMGAILASGILDAGGRNVTIKLLSRNKHDKLTAVVG
LAVFSQFWYWYPLLYFISLAFSPTAFIGLNSDLKVPKFEFLSHAKPSLFEYPKPTTQQTT
TSAVKLPTAILSTYAKAKSRAKKDAESKANQEKATEDASGSSSSKATKTQEKDADAMQVD
NAAEKKAPEPEPTFQILTNPARVIPTQEKFIKFIEGSRYVPVKPAPSGFILLQDMQPTEA
EVLALTDAPSTVAATTGSAAAATGQQASSAMAVDDEPQPPQPFEYTS
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggcagcggcggcggtggccacggtgagctccgcgagcggcatcctcgcgatgctgcag
gagccggcggaggagctcaagctgcacgcgctcgccagcctcaactccgtcgtgcacctc
ttctacccggagatctccaccagcatccccaccattgagagcctgtatgaagacgaggat
tttgaacaaaggcagctcgctgcacttgttgtttctaaggtattttactaccttggggag
ctaaacgatgcactgtcctatgcacttggtgctgggcctctgtttgacatttccgaggat
tctgattatgctcatgctcttttagcaaaagcattggacgagtatgcccgtttaaagacg
aaagctcctaaaggcacgaggaggaagaaatatgtggaccccagattagaggccatagtg
gagagaatgctggagaagtgtattcttgacggtaaatatcagcaggccatgggaatggct
gttgaatgcaggagacttgacaaactggagtcggcgattgttcgatgtgacaatattcat
ggggctctttcgtattgtatcaacctttcccatcaatatgttaaccaccgtgaatatcga
tttgaggttcttcgctgtcttgttaagatataccaaacattgccacatccagattacctg
agtatttgccaatgcttaatgttcttgggcgagcctgaaactgtggcaaacatattggac
aagctgctttctggaagcaaggatgatgctctccttgcgtaccaaattgcctttgatctc
gttgaaaatgaaaatcaagctttccttttgaatgtgaggaatcgtctggcttcacaaact
cctgagtctaaccctgatagtggatcggctttaccggatgatcaagctgctaatgcgggt
acgggcagcacagaaccagctggggatgttcagatgagagatgacacagctacaccaaat
ggtagttctcacacagtagatccaaatgaggtagcacgtgctgataggcttgcgaaaata
aaaggaatactgtcaggggagacatctatccagttgacactgcaatttttgtatagccac
aataggtcggatcttttaattttgaaaacaataaagcaggctgtggaaatgaggaacagt
gtttgccacagtgcaacaatatgtaccaatgcaatcatgcatgctggaacaactgtagac
accttcctaagagagaatctggagtggttaagcagggcaaccaattgggctaaattcagc
gcaaccgctggactaggtgtcattcacagaggccatcttcaacaagggcgagctttgatg
gccccctacctacctcaaagtggtgccgttggtggtggtagtccatactcagaaggaggt
gccctatatgccctgggtttgattcatgctaaccatggtgaagggatcaaacaattcctt
cgtgaaagccttcgcaataccagtgctgaggtgatccagcacggagcctgtttgggcctt
gggcttgcagctttgggaacagcagatgaggagatatatgaggacataaaaaatgttctt
tacacggacagtgctgtggctggtgaagcagctggtattggaatgggcttgcttatggtt
gggacagccagtgagaaggccagtgagatgcttgcttatgctcatgatacacagcatgaa
aagattattaggggtttgtcacttggcattgcgttgacagtttatggcagggaagaggaa
gctgacaccctgattgaacaaatgacaagggatcaagatcccatattacgttacggtggc
atgtatgcattggctctagcctacaggggaactgcaaataacaaagccatacaccagctg
ctgcattttgctgtatcagacgtcagtgacgatgttcggaggactgcagttatggctctt
ggatttgttctatacaatgaacctgagcagactcctagaattgtgtccctgctctctgaa
tcatacaacccacatgtccgttatggtgctgctttagctgttgggatatcatgcgcggga
agtggattaagtgatgcaatttccttgttggagcctctcacatcagatgttgttgacttt
gttcgccagggagctctcattgctatggcgatggtcatgattcagactaatgaatccttt
gattctcgtgttggaacattcaggcgtcaattggaaaagatcattcttgacaaacatgag
gacaccatgagcaaaatgggtgccatactggcttctggtattctagatgctggtggcagg
aatgtcacaatcaaacttctctcaaggaacaagcacgacaagcttactgctgtggttggc
cttgctgttttcagtcagttctggtactggtatcctctcctgtattttattagcttggcc
ttctcgccaacagccttcattggactcaactccgatcttaaagtaccgaagtttgagttc
ttgtcacatgctaaaccatccctctttgagtatcccaaaccgacaacgcaacagactacg
acttcagctgtcaaactgccgacagccattttgtcaacatacgccaaggcgaaatctagg
gcaaagaaggatgcagaaagcaaagctaaccaggagaaagcaaccgaagatgcttctggc
tctagttcaagcaaggccaccaaaactcaggagaaggatgccgatgcaatgcaggttgat
aacgcggcggagaagaaggctcctgaacccgaaccaaccttccagatcctcacaaaccca
gcacgcgtcatccctacccaagagaagttcatcaagtttatcgagggcagccgatatgtc
ccggtgaaacctgctccatctggattcatcctcctccaggacatgcagccaaccgaggcg
gaggtactcgcactcaccgatgccccctcaactgtggctgcgaccactggtagcgccgct
gctgccacaggccaacaggcctcatctgccatggctgtcgacgacgagccgcagccacca
caacctttcgagtacacctcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344971
Entry
4344971           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 1 homolog A
  KO
K03032  26S proteasome regulatory subunit N2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4344971
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4344971
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4344971
SSDB
Motif
Pfam: RPN2_C PC_rep HEAT_2
Other DBs
NCBI-GeneID: 4344971
NCBI-ProteinID: XP_015650371
UniProt: A0A0P0XDC5 Q6Z921
LinkDB
Position
8:7591556..7597014
AA seq 987 aa
MAAAAVMVSSASGLLAMLQEPAAELKLHALANLNSLVHVFWPEISTSVPAIESLYEDEEF
DQRQLAALVVSKVFYYLGELDDSLSYALGAGPLFDPSEGSDYAQTLLAKALDEYASIRSK
SLKAAGEGDEKMDPRLEAIVERMLDKCILDGKYQQAMGMSLECKRLDKLEEAISRSDNLN
GSLSYSIILSHQYVSHREYRCEILRCLVKIYQTLPNPDYLSICQCLMFLGEPETVGNILG
KLLSGSKDDALLAFQIAFDLVENENQAFLLNVKNHLDTLSLQTSAQTLPSDQTAATEPSG
DAQMTDDAITPNGNAHTVDPNEVAHADRLTKIKGILSGETSIQLTLQFLYSHNRSDLLIL
KTIKQALEMRNSVCHSATICSNAIMHAGTTVDTFLRENLEWLSRATNWAKFSATAGLGVI
HRGHLTQGRALMAPYLPQSGAASGGSPYSEGGALYALGLIHANHGEGIKQFLRESLRNTS
SEVVQHGACLGLGLAALGTADEEIFEDVKNILYTDSAVAGEAAGIGMGLLMAGTASEKAG
EMLAYAHDTQHEKIIRGLSLGIALTVYGREEEADTLIEQMTRDQDPILRYGGMYALALAY
RGTANNKAIHQLLHFAVSDVSDDVRRTAVLALGFVLYNEPEQTPRIVSLLSESYNPHVRY
GAALAVGISCAGTGLSDAISLLEPLTSDVVDFVRQGALIAMAMVMIQTNESYDSRVGTFR
RQLEKIILDKHEDTMSKMGAIMATGILDAGGRNVTIRLQSRSKHDKLTAVVGLAVFTQFW
YWYPLTYFISLAFSPTAFIGLNSDLKVPKFEFLSNTKPSLFDYPKPTTQQTTTASVKLPT
AILSTYAKAKSRAKKEAESKAQEKAEAPPSEDASTSMQVDGVAEKKAPEPEPTFQILTNP
ARVVPAQEKFIKFLEGGRYEPVKLAPSGFVLLRDLKPTETEELVLTDAPATQATNAAAAT
AGQQGSGAAAMAVDEEPLPPQPFEYTS
NT seq 2964 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggtgatggtgagctcggcgagcgggctgctggcgatgctgcaggag
ccggcggcggagctcaagctgcacgcgctcgccaacctcaactccctcgtccacgtcttc
tggcccgagatctccaccagcgtccccgccattgagagcttatatgaagatgaggaattc
gaccagaggcagttggcagcattggttgtttccaaggtgttttactaccttggtgaatta
gatgattctctgtcttacgcactcggtgctggaccactatttgatccctccgagggttca
gactatgctcaaacacttttagcaaaagctttagatgaatatgccagcatccgatcgaag
tccttgaaagcagcaggtgaaggggatgaaaaaatggacccaagattggaggcaattgta
gagagaatgctggataagtgtatacttgatggaaaatatcaacaggccatgggtatgtct
cttgaatgcaagagacttgataagctagaggaagcgatatctcgatccgataatcttaat
ggatctctttcttattccatcattctatctcatcaatatgttagtcaccgtgaatatcgc
tgtgagattctccgatgtcttgtaaaaatataccagacactgccaaatccggattactta
agcatttgccagtgtcttatgttcttgggtgagcctgaaactgttggaaacatcttgggc
aagctgctttctggaagcaaggatgatgctctccttgcattccaaattgcttttgatctt
gttgaaaatgaaaaccaggccttcctcctgaatgtgaaaaatcaccttgacacgctgagt
ttgcagacttctgcccagactttacctagcgatcaaactgctgctacagaaccatctgga
gatgcccaaatgacggatgatgctatcacaccaaatggaaatgcgcacactgtagatcca
aatgaagtagcgcacgctgataggctgaccaaaattaaggggatactgtcaggggagacg
tctattcagttgacattgcagtttttatacagtcataataggtctgatcttctgattttg
aagactataaaacaagctctggaaatgaggaatagtgtttgtcatagtgcaactatatgt
tccaatgcaatcatgcatgcaggaacaacagttgataccttcctaagagaaaacttggaa
tggctaagtagggcaaccaactgggctaagttcagtgcaactgctggattaggtgtcatt
catagaggccatctcacacaaggcagagctttaatggccccataccttcctcagagtggt
gctgcaagtggtggtagtccatattctgaaggtggtgccctttatgctctgggtctgatc
catgcaaaccatggtgaaggaatcaaacaatttcttcgtgagagccttcgcaacactagt
tctgaggtcgttcagcatggtgcttgtctgggacttggacttgcagctttaggcacagcc
gacgaggaaatatttgaggatgtaaagaatattctttacactgacagtgctgtggctggt
gaggctgctggcattggcatgggcttgcttatggctggaacagccagtgagaaggctgga
gagatgcttgcctatgcacatgatacacagcatgagaaaattattcggggcttgtcactt
ggaattgcattgacagtttatggcagggaagaggaagctgacaccttgattgaacaaatg
actagagatcaagatcccatactccgttatggtggtatgtacgcattggctctagcgtac
aggggaactgcaaataacaaagctatccaccagcttcttcattttgcggtgtcagatgtg
agcgacgatgtccggaggactgcagtattggctcttggttttgtcctgtacaatgagcct
gagcagactccaagaattgtgtctctgctctctgaatcatataatccgcatgtccgttat
ggtgccgctttagctgttggaatatcctgtgcaggaacaggattaagtgatgccatctcc
ttgttggagcctcttacatctgatgttgttgacttcgtgcggcaaggtgctctcattgca
atggcaatggtcatgatccaaactaatgaatcatatgactctcgtgttggaacattcagg
cgtcagttggaaaagatcattctcgacaagcatgaggacaccatgagcaaaatgggtgcc
ataatggctactggtatccttgatgctggtggtaggaacgttaccatcaggcttcagtcc
aggtcaaagcatgacaagctgactgctgttgttggccttgccgtcttcacccagttctgg
tattggtacccgctgacatatttcatcagcctggccttctctccgacggcttttattggc
ctcaactctgacttgaaagtgccgaagtttgagttcctgtcaaacactaaaccatcgctc
tttgattacccaaagccgacaacccaacaaaccacgactgcttcagttaagctgcctacg
gccatcctatcaacatatgccaaggcaaaatctagggcaaagaaggaagccgaaagcaaa
gctcaggagaaagcagaagcaccaccaagtgaagatgcttctacttcaatgcaggtcgat
ggtgtggcggagaagaaagcccctgagcccgaaccgaccttccagatcctgactaacccg
gcccgggttgtcccggcccaggagaagttcataaaattcctggagggcggcaggtacgag
cctgtgaagctggcgccctccggatttgtcctcctacgggacctcaagcccaccgagacg
gaggaactagtcctcaccgacgccccggcaactcaggcgacgaacgccgcagccgccacc
gctggccagcaaggctcaggcgccgccgccatggccgtcgacgaggagcccctgccaccc
cagccatttgagtacacctcgtga

DBGET integrated database retrieval system