KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336977
Entry
4336977           CDS       T01015                                 
Name
(RefSeq) UDP-N-acetylglucosamine diphosphorylase 2 isoform X1
  KO
K00972  UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase [EC:2.7.7.23 2.7.7.83]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4336977
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     4336977
    2.7.7.83  UDP-N-acetylgalactosamine diphosphorylase
     4336977
SSDB
Motif
Pfam: UDPGP NTP_transf_3
Other DBs
NCBI-GeneID: 4336977
NCBI-ProteinID: XP_015633456
LinkDB
Position
4:complement(31108930..31113473)
AA seq 497 aa
MKEIVVGSVAAAAAVGRWGAAPPQAMLERMKDYGQEGAFALWDELSPEDRELLVRDIEVS
ERSLDLSRIDRIIRRSLGSQGFTLPTVEPVPESSVSKVEERLPEDKERWWKKGLKAISEG
KLAVVLLAGGQGTRLGSSDPKGCFSIGLPSGKSLFQLQAERILCVQKLAAQSSDSPNNTV
PIHWYIMTSPFTDDITRKFFESRKYFGLEADQVTFFQQGTLPCVSADGRFIMETPYKVAK
APDGNGGVYAALKSRRLLEDMSSRGVKYVDCYGVDNALVRVADPTFLGYFIDKAVSSAAK
VVRKAYPQENVGVFVRRGRGGPLSVVEYSEMDAAMATEINQSTGRLRYCWSNICLHMFTL
DFLNQVANSLEKDSTYHLAEKKIPSIHGYAMGLKLEQYIFDAFSYSPSTALFEVLREEEF
APVKNANGASYDTPDSAKLMLLRLHSRWVVAAGGFLTHSVPLYMTGVEVSPLSSYAGENL
EAICRGRTFHAPSEISF
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaaggagatagtggttgggtcggtggcggcggcggcggcggtggggaggtggggagcg
gcgccgccgcaggcgatgctggagaggatgaaggattacgggcaggagggcgcgttcgcg
ctctgggacgagctctcgcccgaggaccgggagctgctcgtcagggacatcgaggtgagc
gagcgaagcctggatctttcaaggattgatcggatcatccggcgctcccttggatcacaa
ggattcactttgcccaccgtcgagccggtgccggagtccagcgtgtccaaggtggaggag
aggttgccggaggacaaagaacggtggtggaagaaggggctgaaggccatttcggagggg
aagctagccgtcgtccttttagccggtggtcaggggactcggcttggtagctctgatcct
aaaggatgtttcagtatcggacttccgtctggaaagtcgcttttccaactccaagctgaa
cggattttgtgtgttcaaaagcttgctgctcaatcaagtgatagtccaaataacaccgta
cctattcattggtatataatgaccagccccttcaccgatgacatcactcgcaaattcttc
gaaagccgtaaatactttggcttagaggcagaccaagtgacatttttccaacaaggcacc
cttccatgtgtttctgctgatggcagatttattatggagacaccatacaaggtagcaaag
gctcctgatggcaatggtggagtttatgctgccctcaagtccagaaggttgctggaagat
atgtcttcacggggtgtaaagtatgtagattgctacggggttgacaatgcactggtccgc
gttgctgatccgacgttcctaggttacttcatagacaaagctgtatcttctgctgcaaag
gttgttaggaaggcttacccacaagagaatgttggagtatttgttcgacgaggacgtggt
ggacctctctctgtagttgagtatagtgaaatggacgcagctatggctactgaaattaat
cagtcaacgggacgccttcgttattgttggagcaatatttgcttgcatatgttcactttg
gattttttgaatcaagtagcaaacagccttgagaaggacagtacttatcatcttgctgag
aagaagatcccttccatccatgggtacgcaatgggcttgaagcttgaacagtatatattc
gacgcgttcagttactccccatccacagcactttttgaggttttgcgggaggaggaattt
gcgcctgtaaagaatgcgaatggcgcgtcttatgatacccctgatagcgcaaagctgatg
ctgcttcgtctccatagtagatgggtagttgctgctggtggcttcttgacccattctgtc
ccattgtacatgacaggtgtggaagtttctccacttagctcctatgctggagaaaacttg
gaagccatttgccgcggacggacattccatgcgccgagtgagatttccttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344934
Entry
4344934           CDS       T01015                                 
Name
(RefSeq) UDP-N-acetylglucosamine diphosphorylase 1
  KO
K00972  UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase [EC:2.7.7.23 2.7.7.83]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4344934
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     4344934
    2.7.7.83  UDP-N-acetylgalactosamine diphosphorylase
     4344934
SSDB
Motif
Pfam: UDPGP NTP_transf_3
Other DBs
NCBI-GeneID: 4344934
NCBI-ProteinID: XP_015650402
UniProt: Q6ZJ97 Q6ZKK1
LinkDB
Position
8:6237421..6242118
AA seq 489 aa
MAEIVVAPRAPAPAGRWGAAPPQELVERLKDYGQEGAFALWDELAPEERDFLVRDIESLD
LARIDRIVRCSLRSQGVPLPAVEPVPESSVSTVEDRTPEDKQRWWKRGLKAISEGKLAVV
LLAGGQGTRLGSSDPKGCFSIGLPSGKSLFQLQAERILCIQKLAAQSTDGTPQIHWYIMT
SPFTDEATRKFFESHRYFGLEPDQVTFFQQGTIPCVSADGRFIMETPYKVARAPDGNGGV
YAALKSQRLLDDMAGRGVKYVDCYGVDNVLVRVADPTFLGYFIDKGVSAAAKVVRKAYPQ
EKVGVFVQRGRGGPLSVVEYSEMDAAMTTEINQGTGRLRYCWSNVCLHMFTLDFLNQVTN
SLEKDSIYHLAEKKIPSIHGYTAGLKLEQFIFDVFTYSPSTALFEILREEEFAPVKNANG
ATYDTPDSARLMLLRLHSRWVVAAGGFLTHSVPLYMTGVEVSPLSSYAGENLEAICRGRT
FHAPSEISF
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcggagatcgtggtggcgccgcgggcgccggcgccggcggggaggtggggcgccgcg
ccgccgcaggagctggtcgagaggctcaaggactacggccaggagggcgccttcgcgctc
tgggacgagctcgcccccgaggagcgcgacttcctcgtccgggacatcgagagcctagat
cttgctaggattgaccggatcgtccgatgctcgctcagatcacaaggtgttcctttgcca
gccgtcgagcctgtgccggagtcgagtgtctcgaccgtcgaagatagaactcctgaggac
aagcagaggtggtggaagaggggcttgaaagccatttcagaggggaaattggctgttgtc
cttttggctggtggtcagggaacaaggcttggcagttctgatcctaagggatgcttcagc
atcgggcttccatctggaaagtcacttttccaacttcaagctgaacgaattttgtgcata
cagaagctggctgctcagtccactgatggtactccacaaatacactggtatataatgact
agcccctttactgatgaagcgactcgaaaattttttgaaagccacagatattttggctta
gagcctgaccaagtaacatttttccagcaaggtactatcccatgtgtctcagctgatgga
aggtttattatggaaacaccatacaaggtagcaagggctcctgatggcaatggtggagtg
tatgctgctctaaaatctcaaaggttgctggacgatatggctggaagaggtgtgaaatat
gtagattgctatggagttgacaatgtattggtccgtgttgctgatccaacattcctagga
tatttcattgacaagggcgtgtctgctgctgcaaaggtcgtaaggaaggcatatccacag
gagaaagttggagtgtttgttcagcgtggcaggggtgggcctctttctgtagttgagtac
agtgaaatggatgcagctatgactactgaaataaatcaaggcacagggcgccttcgttat
tgttggagcaatgtatgcctgcatatgtttactttggattttcttaatcaagtaacaaat
agtcttgaaaaggacagcatttaccatttagcagagaagaagattccttcaatccatggg
tacacggcaggcttaaagcttgaacagtttatatttgacgtgttcacctattctccatca
acagctctttttgagattttgagggaggaggaatttgcaccagtaaagaatgctaatggt
gcaacttatgatactcctgatagtgccagattaatgctgctccgccttcacagccgatgg
gtggtagctgcaggtggctttttgactcattccgtgcccttgtatatgacaggtgttgaa
gtttctccacttagctcttatgcgggagagaacctggaagccatatgccgtggacggaca
ttccatgcaccgagtgagatttcattttag

DBGET integrated database retrieval system