KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337007
Entry
4337007           CDS       T01015                                 
Name
(RefSeq) imidazoleglycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00340  Histidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    4337007
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     4337007
SSDB
Motif
Pfam: IGPD
Other DBs
NCBI-GeneID: 4337007
NCBI-ProteinID: XP_015634974
UniProt: Q7XTN6 Q7FA25
LinkDB
Position
4:31389656..31393319
AA seq 269 aa
MTTARFVSPSLSRVSPSPAGRVSGSSWLSRAGVALPARPHGLSLHLRPPAMASAAAAGNG
SPSAPEDSTALSRIGEVKRVTKETNVHVKINLDGTGVADCSTGIPFLDHMLDQLASHGLF
DVCVKAKGDTHIDDHHSNEDIALAIGTALLEALGDRKGINRFGHFTAPLDEAAVEVILDL
SGRPHLSCGLSIPTERVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGKNSHHIIEATFKA
FARALRQATEYDLRRRGTVPSSKGVLSRS
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaccaccgcgcggttcgtctccccctccctctcgcgcgtgtccccctcgccggccggc
cgagtctccgggtcgtcgtggttgtccagggctggggtcgccctccccgctcggccgcac
ggtctctcgctccacctgaggccgcctgctatggcctccgccgccgccgccgggaacggc
tctccttccgcgccggaggactccacagcgttgtccaggataggagaagtcaagagggtg
accaaggagacgaatgtgcatgtgaagatcaacctggatggcactggtgttgccgattgc
agcacagggatacctttcttggatcacatgctcgatcaactggcatctcatgggctcttt
gacgtatgtgttaaggcaaagggtgacactcacatcgatgaccatcactcaaacgaagac
atcgctttggcaattggaacggcactacttgaagcacttggagatcgaaaaggaattaat
cggtttgggcattttacagcaccacttgatgaggcagcggttgaggttatactggatcta
tctggtcgtcctcatttgagttgcggcttaagtattccgactgagagagttggcacatac
gatactcagctagttgagcactttttccaatctcttgtgaatacatctgggatgacactt
cacatccgtcagcttgctggaaaaaactcacaccatattattgaggcaactttcaaagca
tttgctagagcccttcgacaagcaacagaatatgacttgcgccgacgcggcactgtcccc
agctcaaaaggtgtgttgtcaaggtcatag

DBGET integrated database retrieval system