KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337011
Entry
4337011           CDS       T01015                                 
Name
(RefSeq) probable UDP-arabinose 4-epimerase 2
  KO
K12448  UDP-arabinose 4-epimerase [EC:5.1.3.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4337011
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.5  UDP-arabinose 4-epimerase
     4337011
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind NAD_binding_10 NAD_binding_4 adh_short KR
Other DBs
NCBI-GeneID: 4337011
NCBI-ProteinID: XP_015634966
UniProt: Q8H0B6
LinkDB
Position
4:31403368..31407253
AA seq 391 aa
MDFGDSRRKPNVVGKFTVAVALTVMCIIVLKQSPGFTSTSVFSRHEIGVTHVLVTGGAGY
IGSHATLRLLRDNYRVTIVDNLSRGNMGAVRVLQRLFPEPGRLQFIYADLGDAKAVNKIF
SENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLTVLEAMAAYNVKTLIYSSTCATYG
EPDTMPITEATPQNPINPYGKAKKMAEDIILDFSKRSEMAVMILRYFNVIGSDPGGRLGE
APRPELREHGRISGACFDAALGIIPGLKVRGTDYPTADGTCIRDYIDVTDLVDAHVKALD
KAQPGKVGIYNVGTGHGRSVKEFVEACKSATGASIKVSFLTRRPGDYAEVYSDPSKIHDE
LNWTARYIDLRESLSTAWKWQKAHPNGYGSA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggacttcggtgattctagacgcaagcctaatgtcgtcgggaagttcaccgtagctgtt
gcactcacggtcatgtgcatcattgtgttgaaacagtcgcctggttttaccagtacaagt
gtgttctctcgccatgaaattggtgtgactcatgtgttggtgactggaggagctggatac
attgggtcacatgctactcttcgtctacttagggacaactaccgagttaccattgtggat
aacctttctagagggaacatgggagctgtcagagtccttcaacgtttgtttccagagcct
gggaggcttcagtttatttatgctgatttaggcgatgcgaaagctgttaacaaaatattt
tcagaaaatgcattcgatgctgttatgcactttgctgccgttgcttacgttggtgagagc
acgttggagccactgaggtactaccacaacataacatcaaatacattgacagtgcttgag
gcaatggcagcatataatgtaaaaactctgatatactcaagtacttgtgcaacatatggt
gaacctgacacaatgcctatcacagaagcaacccctcagaatcctatcaatccatatggg
aaggcaaaaaagatggcagaggacatcattttagatttctctaagagatcagaaatggca
gtcatgatcttaagatacttcaacgtcattggatcagacccaggggggcggttaggggaa
gctccacgaccagagctgcgtgagcatggacggatttctggtgcttgctttgatgcagca
ctgggaatcattccaggtttgaaggttcggggaactgattaccctacagctgatggaact
tgcataagggactatattgatgtcacggatctcgttgatgctcatgtgaaagctcttgat
aaagctcagcctggcaaagttggaatctacaatgttggcacaggacatggtagatcagtg
aaggagtttgtagaagcatgtaagagcgcaacaggagctagcatcaaggtttcattcctt
acccggagaccaggagactatgctgaagtttacagtgacccatccaaaatccatgacgag
ctgaactggacagcccgttacattgatcttcgcgaaagcctttcaactgcatggaaatgg
cagaaagcacacccgaatgggtatggatcggcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342364
Entry
4342364           CDS       T01015                                 
Name
(RefSeq) probable UDP-arabinose 4-epimerase 1
  KO
K12448  UDP-arabinose 4-epimerase [EC:5.1.3.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4342364
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.5  UDP-arabinose 4-epimerase
     4342364
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 NAD_binding_4 adh_short KR DUF5117 UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 4342364
NCBI-ProteinID: XP_015647690
UniProt: Q8H930
LinkDB
Position
7:2080061..2083369
AA seq 421 aa
MLPTNRNRPQQRPARSWYFISDMDFSDPKRKPRYLSKILMVALLTAMCVVMLTQPPCHRR
TPSVFSIHEPGVTHVLVTGGAGYIGSHAALRLLKDSFRVTIVDNLSRGNMGAIKVLQNLF
SEPGRLQFIYADLGDPKAVNRIFAENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLV
VLEAMAAHNVRTLIYSSTCATYGEPEKMPITEGTPQFPINPYGKAKKMAEDIILDFSKSK
KADMAVMILRYFNVIGSDPEGRLGEAPKPELREHGRISGACFDAALGIIPGLKVKGTDYE
TPDGTCVRDYIDVTDLVDAHVKALNKAERGKVGIYNVGTGKGRSVKEFVEACKKATGVDI
KVDYFPRRPGDYAEVYSDPAKINSELNWTAQHTDLLESLRVAWTWQKKHRSGYGPPQAMV
L
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcttcccaccaacaggaacaggccccagcagaggcctgccagatcttggtatttcatc
tcagacatggacttctccgatccgaagcgcaagccgcggtacctcagtaagatcctcatg
gtggcgctcctcaccgccatgtgcgtcgtcatgctcacacagccgccctgccataggagg
actcccagtgtgttctccatccatgaacccggagtcacgcatgttctagtgacgggcggc
gctggatatatcggttcgcacgctgcgcttcggctgctgaaagattccttcagagtcacc
atagtggataatctttcaagaggaaatatgggggcaatcaaggttcttcagaacttgttt
tcagagcctgggcggttgcagttcatctatgctgatttaggcgatccaaaagctgttaat
agaatatttgcagaaaatgcttttgatgctgtcatgcactttgctgctgtcgcttatgtt
ggtgagagcacacttgagcctttgaggtactatcataacatcacctcaaacactttagtt
gtgctagaggctatggcagcacacaatgtgagaaccctgatctactctagcacatgtgcc
acctatggagaacccgagaagatgcctatcaccgaaggaactccccagtttccgatcaac
ccatatggtaaagccaagaagatggcagaggacatcatcttggatttttccaaatccaag
aaggcagacatggctgtgatgattctaagatacttcaacgtcattggttctgaccctgaa
ggaaggcttggcgaggctccaaaacctgaattacgggagcatggccgtatatctggtgca
tgctttgatgctgcactggggataattcctggtttgaaggttaaaggtactgactatgaa
acacctgacggtacttgtgtaagagattacatcgatgtcactgacctcgttgacgcccat
gtgaaggcgctcaacaaggcggaaaggggcaaagttggcatatacaatgttggcacaggc
aaaggtaggtcagtgaaagaatttgtcgaagcttgcaagaaggcaacaggagttgacatc
aaggtcgactacttccctcgtcgacccggtgactatgccgaagtgtacagcgatcccgca
aagatcaacagcgagctgaactggactgctcaacataccgatctcctggagagcctcagg
gttgcctggacatggcagaagaagcaccggagcggctacggaccccctcaggccatggtt
ttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344584
Entry
4344584           CDS       T01015                                 
Name
(RefSeq) probable UDP-arabinose 4-epimerase 3
  KO
K12448  UDP-arabinose 4-epimerase [EC:5.1.3.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4344584
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.5  UDP-arabinose 4-epimerase
     4344584
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 NAD_binding_4 adh_short KR NmrA DUF5117
Other DBs
NCBI-GeneID: 4344584
NCBI-ProteinID: XP_015649744
UniProt: Q8H0B2
LinkDB
Position
8:1666965..1672047
AA seq 406 aa
MIPLNRRASQTRGGMEYFDARRKPHNVGKVIAALVLTTLCIFILKQSPGFGGSSVFSRHE
PGVTHVLVTGGAGYIGSHASLRLLKDNYRVTIVDNLSRGNMGAVKVLQELFPQPGRLQFI
YADLGDQKTVNKIFAENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLLILEAMASHG
VKTLIYSSTCATYGEPEKMPIVETTRQLPINPYGKAKKMAEDIILDFTKGRKDMAVMILR
YFNVIGSDPEGRLGEAPRPELREHGRISGACFDAALGIIPGLKVKGTDYPTTDGTCIRDY
IDVTDLVDAHVKALNKAEPSKVGIYNVGTGRGRSVKEFVDACKKATGVNIKIEYLSRRPG
DYAEVYSDPTKINTELNWTAQYTDLKESLSVAWRWQKSHPRGYGSN
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgattccgctaaacaggagggcgagtcagactaggggtgggatggagtacttcgatgct
aggcggaagcctcataatgttgggaaagttattgcagctctggtcctcacaacactatgt
atatttattttgaagcaatctcctggttttggtggcagtagtgtgttttctcgccatgaa
cctggtgttactcatgtcttagtaacaggaggagctggctatattgggtcacatgcttca
ttacgcctgttaaaggacaattatcgagttaccattgtggacaatctttctagaggaaac
atgggagcagtaaaggttctccaagagttgttcccccagccaggaagacttcagtttatc
tatgctgatcttggagatcaaaaaactgtcaacaagatctttgccgaaaatgcgtttgat
gctgttatgcactttgctgctgttgcctatgtgggtgagagtacattggaaccccttagg
tactatcacaatattacatcgaacaccttattgattttggaggctatggcgtctcatgga
gtcaagacccttatttactctagtacatgtgccacctatggagaaccagagaagatgcct
attgtagaaaccacacgtcagttaccaattaatccctatggaaaagctaagaaaatggcg
gaggacatcatactagatttcacgaaggggagaaaggacatggctgtgatgattttaaga
tatttcaatgttattggatcagacccagagggaagactaggtgaagctcctagacctgaa
ctacgagagcatggaaggatatccggggcatgctttgatgctgcgttaggaatcattcca
gggctgaaggttaaaggaacagattatcctacaactgatggaacctgcataagagactac
attgatgtcacagatcttgttgatgctcatgtgaaagcactcaacaaggcagagccaagt
aaagttggcatttacaatgttggcactggaagaggtcgttcagtcaaggagtttgtggat
gcctgcaaaaaggcaactggagtcaacattaaaattgagtacctcagcaggaggccaggg
gactatgctgaagtatacagtgacccaacaaagatcaacacggagctcaactggactgct
caatataccgacctcaaggagagcctgtcagtcgcttggagatggcaaaagtcacatcca
cgcggatatgggtcaaactaa

DBGET integrated database retrieval system