KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337016
Entry
4337016           CDS       T01015                                 
Name
(RefSeq) LRR receptor-like serine/threonine-protein kinase FLS2
  KO
K13420  LRR receptor-like serine/threonine-protein kinase FLS2 [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4337016
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4337016
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4337016
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4337016
Protein kinases [BR:osa01001]
 Serine/threonine kinases: TKL group
  IRAK family
   4337016
SSDB
Motif
Pfam: LRR_8 LRR_4 Pkinase PK_Tyr_Ser-Thr LRRNT_2 ABC1 TMEM154 SIT
Other DBs
NCBI-GeneID: 4337016
NCBI-ProteinID: XP_015634951
UniProt: Q0JA29
LinkDB
Position
4:complement(31420797..31425209)
AA seq 1183 aa
MERNKFASKMSQHYTKTICIAVVLVAVLFSLSSAAAAGSGAAVSVQLEALLEFKNGVADD
PLGVLAGWRVGKSGDGAVRGGALPRHCNWTGVACDGAGQVTSIQLPESKLRGALSPFLGN
ISTLQVIDLTSNAFAGGIPPQLGRLGELEQLVVSSNYFAGGIPSSLCNCSAMWALALNVN
NLTGAIPSCIGDLSNLEIFEAYLNNLDGELPPSMAKLKGIMVVDLSCNQLSGSIPPEIGD
LSNLQILQLYENRFSGHIPRELGRCKNLTLLNIFSNGFTGEIPGELGELTNLEVMRLYKN
ALTSEIPRSLRRCVSLLNLDLSMNQLAGPIPPELGELPSLQRLSLHANRLAGTVPASLTN
LVNLTILELSENHLSGPLPASIGSLRNLRRLIVQNNSLSGQIPASISNCTQLANASMSFN
LFSGPLPAGLGRLQSLMFLSLGQNSLAGDIPDDLFDCGQLQKLDLSENSFTGGLSRLVGQ
LGNLTVLQLQGNALSGEIPEEIGNMTKLISLKLGRNRFAGHVPASISNMSSLQLLDLGHN
RLDGVFPAEVFELRQLTILGAGSNRFAGPIPDAVANLRSLSFLDLSSNMLNGTVPAALGR
LDQLLTLDLSHNRLAGAIPGAVIASMSNVQMYLNLSNNAFTGAIPAEIGGLVMVQTIDLS
NNQLSGGVPATLAGCKNLYSLDLSGNSLTGELPANLFPQLDLLTTLNISGNDLDGEIPAD
IAALKHIQTLDVSRNAFAGAIPPALANLTALRSLNLSSNTFEGPVPDGGVFRNLTMSSLQ
GNAGLCGGKLLAPCHGHAAGKKRVFSRTGLVILVVLIALSTLLLLMVATILLVSYRRYRR
KRRAADIAGDSPEAAVVVPELRRFSYGQLAAATNSFDQGNVIGSSNLSTVYKGVLAGDAD
GGMVVAVKRLNLEQFPSKSDKCFLTELATLSRLRHKNLARVVGYAWEAGKIKALVLDYMV
NGDLDGAIHGGAAAPPPAPSRWTVRERLRVCVSVAHGLVYLHSGYDFPVVHCDVKPSNVL
LDGDWEARVSDFGTARMLGVHLPAAANAAAQSTATSSAFRGTVGYMAPEFAYMRTVSTKV
DVFSFGVLAMELFTGRRPTGTIEEDGVPLTLQQLVDNAVSRGLDGVHAVLDPRMKVATEA
DLSTAADVLAVALSCAAFEPADRPDMGAVLSSLLKMSKLVGED
NT seq 3552 nt   +upstreamnt  +downstreamnt
atggagaggaataaatttgcaagcaaaatgtcgcagcattacacgaagacgatttgcatt
gccgtcgtcttggtggccgtgctgttctcgttgtcgtcggcggcggcggccggctccggt
gcggcggtgtccgtgcagctcgaggcgctgctggagttcaagaacggcgtcgccgacgac
ccgctcggcgtgctggccggctggagggtggggaagtccggtgatggcgccgtccgcggc
ggcgcgctgccgcggcattgcaactggacgggcgtcgcctgcgacggcgccggccaggtg
acgtccatccagctgccggagtcgaagctccggggcgcgctctccccgttcctcggcaac
atctcgacgctccaggtcatcgacctgacgtcgaacgccttcgccggcggcatcccgccg
cagctcggccgcctcggcgagctcgagcagctagtcgtttcttcgaactacttcgccggc
ggcatcccgagcagcctctgcaactgctcggcgatgtgggctctcgccctgaacgtcaac
aacctcaccggcgcaatcccttcttgcatcggggatctgtccaatctcgagatcttcgaa
gcctacctgaacaatcttgacggggagttgccgccgtccatggcgaagctcaaaggcatc
atggtcgttgacctcagctgcaaccagctgtctggctcgatcccgccggagatcggcgac
ctgtcgaacctgcagattcttcagctgtacgagaaccggttctccggccacatcccgcgg
gagctcggccggtgcaagaacctcaccttgctcaacatattcagcaacgggttcaccggc
gagatccccggcgagctcggcgagctcacgaacctggaggtcatgcgcctgtacaagaac
gcgctcacgtcggagatcccccggtcgctccggcgttgcgtgtcgctgctgaatctcgac
ctgtcgatgaaccagctcgccgggcccatcccgccggagctcggcgagctcccgtcgctc
cagagattgtcgctccatgccaaccggctcgccgggacggttccggcgtcgctgacgaat
ctcgtcaacctgaccatcctggagctgagcgagaaccacctgtccgggccgcttccggcg
agcatcgggtcactgcggaatctccggcggctcatcgtccagaacaactcgctctccggc
caaattccggcgagcatcagcaactgcacgcagctggccaacgcgagcatgagcttcaac
ttgttctccgggccattgccggcggggctcggccggctacagagcctcatgttcttgtcg
ctcggccaaaactcgttggccggcgacatacccgatgacctgttcgactgcggccaactc
cagaagctcgacctgtcagagaacagcttcaccggcggcctgagccgccttgtcggccag
ctcggtaacctcacagtgctgcagctgcaggggaacgctctgtcaggtgagataccggag
gagatcggcaacatgacgaagctcatcagcctgaaactcggcaggaaccggttcgccgga
catgtcccggcgagcatctcgaacatgtcctccctccagttgctcgatctggggcacaat
cgcctcgacggcgtgttcccggctgaggtgttcgagctgcggcagctcaccatcctcggc
gccgggtcgaacaggttcgccggccccatccccgacgccgtcgccaacctccggtcgctc
tcgttcctggacctgtcgagcaacatgctcaacggcacggtgcccgcggcgctgggcagg
ctcgaccagctcctcacgctggacctctcgcacaaccgcctcgccggcgccatccccggc
gcggtgatcgcgagcatgagcaacgtgcagatgtacctcaacctgtcgaacaacgcgttc
acgggcgcgatcccggcggagatcggcggcctcgtgatggtccagaccatcgacctgtcg
aacaaccagctgtccggcggcgtcccggcgacgctcgccgggtgcaagaacctctactcg
ctcgacctctccggcaacagcctcaccggcgaactcccggccaacctcttcccccagctc
gaccttctgacgaccctgaacatctccggcaacgacctcgacggagagatccccgccgac
atcgccgcgctgaagcacatacagacgctcgacgtgtcgaggaacgcgttcgccggggcc
ataccgccggcgctggcgaacctgacggcgctccggtctctcaacctttcgtcgaacacc
ttcgagggccccgtccccgacggcggcgtgttccggaacctgaccatgtcgagcctgcag
gggaacgccggcctctgcggcgggaagctcctcgcgccatgccacggccacgccgccggg
aagaagcgggtgttctcgcggacggggctcgtgatcctcgtcgtgctcatcgcgctgtcg
acgctgctcctcctcatggtcgcgacgatcctgctcgtcagctaccgccggtacaggagg
aagagacgtgccgccgacatcgccggcgactcgccggaggccgccgtcgtggtgccggag
ctgaggaggttcagttacggccagctggcggccgccaccaactcgttcgaccaaggcaac
gtcatcgggagcagcaacctgagcacggtgtacaagggcgtgctcgccggcgacgccgac
ggcggcatggtcgtcgccgtgaagcggctgaacctggagcagttcccgtccaagtccgac
aagtgcttcctcaccgagctcgccacgctgagccggctgcggcacaagaacctggcgcgt
gtggtcgggtacgcgtgggaggccggcaagatcaaggccctggtcctcgactacatggtc
aacggcgacctggacggcgcgatacacggcggcgccgccgcgccgccgccggcgccgtcg
cggtggacggtcagggagcggctgcgggtgtgcgtgtcggtggcgcacgggctggtgtac
ctccactccgggtacgacttccccgtcgtgcactgcgacgtcaagccgtccaacgtcctg
ctcgacggcgactgggaggcgcgcgtcagcgacttcggcaccgcgcgcatgctgggcgtc
cacctgcccgccgccgccaacgccgcggcgcagtcgacggccacctcgtcggcgttccgg
ggcaccgtgggttacatggctccagagttcgcgtacatgaggacggtgtcgacgaaggtg
gacgtgttcagcttcggggtgctggcgatggagctcttcaccgggcggcggccgacgggg
acgatcgaggaggacggcgtgccgctgacgctgcagcagctcgtcgacaacgcggtctcg
agggggctcgacggcgtccacgccgtcctggacccccgcatgaaggtcgccaccgaggcc
gacctgtccacggcggcggacgtgctcgccgttgccctgtcctgcgccgcgttcgagccg
gccgaccggcccgacatgggcgccgtgctctcgtccttgctcaagatgagcaagctcgtc
ggagaagactga

DBGET integrated database retrieval system