KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337051
Entry
4337051           CDS       T01015                                 
Name
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4337051
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4337051
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4337051
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     4337051
SSDB
Motif
Pfam: GCV_T GCV_T_C
Other DBs
NCBI-GeneID: 4337051
NCBI-ProteinID: XP_015635501
UniProt: Q0J9Z5 Q7XPR2
LinkDB
Position
4:31700840..31703597
AA seq 408 aa
MRGLLACATLARRAAGATSTARRHLAGAAEAAEAELKKTALYDFHVAHGGKMVPFAGWSM
PIQYKDTIMDSTLNCRANGSLFDVSHMCGLSLHGRQAIPFLESLVVADVAALKDGTGTLT
VFTNDRGGAIDDSVVTKVTDQHIYLVVNAGCRDKDLAHIGEHMEAFNKKGGDVKWHVHDE
RSLLALQGPLAAPTLQLLTKEDLSKMYFSDFKMIDINGYACFLTRTGYTGEDGFEISVPS
ENAVDLAKALLEKSEGKVRLTGLGARDSLRLEAGLCLYGNDMEQHITPVEAGLSWAIGKR
RKAEGGFLGADVILKQLQEGPKIRRVGLLSQGPPPRSHSEIVSNSGENIGEVTSGGFSPC
LKKNIAMGYVKSGLHKAGTEFKVVVRGKSYDAVVTKMPFVPTKYYKPS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgagagggctactcgcgtgcgccacgctcgcccgccgcgccgccggcgcgacgtcgacg
gcgcggcggcacctggcgggcgcggccgaggcggcggaggcggagctgaagaagacggcg
ctgtacgacttccacgtcgcgcacggcgggaagatggtgccgttcgccgggtggagcatg
cccatccagtacaaggacaccatcatggactccaccctcaactgccgcgccaacggcagc
ctcttcgacgtctcccacatgtgcggcctcagcctccacggccgccaggccatccccttc
ctcgagtccctcgtcgtcgccgacgtcgcggcgctcaaggacggcaccgggacgctcacc
gtcttcaccaacgaccgcggcggcgccatcgacgactccgtcgttaccaaggtcaccgac
cagcacatctacctcgtcgtcaacgccgggtgcagggacaaggatctcgcccacattggg
gagcacatggaggccttcaacaagaagggcggcgacgtcaagtggcacgtccacgatgag
cgctcgcttcttgcattgcagggacctcttgctgcaccaactctccagttgctgacaaaa
gaagatttaagcaaaatgtatttcagtgacttcaagatgattgacatcaatggatatgct
tgctttctcaccagaactggttataccggtgaagatgggtttgaaatctctgttccatca
gagaatgcagttgatcttgcaaaggccctcctggagaaatctgaaggcaaggtgagactg
actggtttaggtgcccgtgacagtctccgcttggaggctggcctctgcctgtacggcaac
gacatggagcaacacatcacaccagttgaggctggtctctcatgggcaattggcaagagg
aggaaagcagaaggcggcttcctgggagcagatgtgatcctcaagcagctccaggaaggc
ccaaagatcaggcgtgtcggtctcctctcgcaaggaccgcctcctcggagtcatagtgag
attgtgagcaactccggggagaacattggtgaggttaccagtggagggttcagcccctgc
ttgaagaagaacatcgccatgggctacgtaaaatccggtttgcacaaggctgggacagag
ttcaaggttgtcgtccgtgggaagtcctacgatgccgtcgtcaccaagatgccgttcgtg
ccgaccaagtactacaaaccctcatag

DBGET integrated database retrieval system