KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337055
Entry
4337055           CDS       T01015                                 
Name
(RefSeq) polyphenol oxidase I, chloroplastic
  KO
K00422  polyphenol oxidase [EC:1.10.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00950  Isoquinoline alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4337055
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4337055
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.1  catechol oxidase
     4337055
SSDB
Motif
Pfam: PPO1_KFDV Tyrosinase PPO1_DWL
Other DBs
NCBI-GeneID: 4337055
NCBI-ProteinID: XP_015636216
UniProt: Q0J9Z1 A0A0P0WEZ4
LinkDB
Position
4:31749109..31751609
AA seq 570 aa
MESINVAPGTTATPRMAPPPPPPCITNLQSTLRYNNLLLHRKTKGWKPRNVSCRVDRRDV
LLGISGAAAMVATQGGGGALAAPIQAPDLGDCHQPVDVPATAPAINCCPTYSAGTVAVDF
APPPASSPLRVRPAAHLADRAYLAKYERAVSLMKKLPADDPRSFEQQWRVHCAYCDGAYD
QVGFPGLEIQIHSCWLFFPWHRMYLYFHERILGKLIGDETFALPFWNWDAPDGMSFPAMY
ANRWSPLYDPRRNQAHLPPFPLDLDYSGTDTNIPKDQLIDQNLNIMYRQMISGARKAELF
MGQPYRAGDQPEPGAGTVESVPHNPVHRWTGDPRQPNGEDMGIFYSAARDPVFFAHHGNV
DRMWHIRRGLLFPGDTDFTDPDWLDASFFFYDEEARLVRVRVRDTLDPSALRFTYQDVGL
PWLNAKPSTGAASTPAPAAGAFPATLDKTVRVAVTRPRASRSREEKEEEEEVEIPDHSTY
VKFDVFVNAPESGDGAATCAATCAGSVALAPHGIHREGQLSPRKTEARFGICDLLDDIGA
DGDKTIVVSIVPRCGCDSVTVAGVSIGYAK
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggagagcatcaacgtagcaccaggaacaaccgctacgcctcgcatggcgccgccgccg
ccgccgccgtgcatcaccaacctccagagtacccttcgctacaacaacctgctcttgcac
cgcaagacgaaggggtggaagccgcggaacgtgtcctgcagggtcgaccgccgcgacgtg
ctcctcggcatcagcggcgcggccgccatggtggccacgcagggcggcggcggcgcgctc
gcggcgcccatccaggccccggacctcggcgactgccaccagcccgtggacgtccccgcc
acggcgccggcgatcaactgctgcccgacgtacagcgccggcaccgtcgccgtcgacttc
gcgccgccgccggcgtcctcgccgctccgcgtgcggccggcggctcacctggcggacagg
gcgtacctggccaagtacgagagggccgtgtcgctcatgaagaagctccccgccgacgac
ccccgcagcttcgagcagcagtggcgcgtccactgcgcctactgcgacggcgcgtacgac
caggtcggcttccccggcttggagatccagatacacagctgctggctcttcttcccatgg
cacaggatgtacctgtacttccatgagaggatactgggcaagctgatcggcgacgagacg
ttcgcgctgccgttctggaactgggacgcgccggacggcatgtcgttccccgcgatgtac
gccaacaggtggtcgccgctgtacgacccgcggcgcaaccaggctcacctgccaccgttc
ccgctcgacctcgactacagtggaaccgacacgaacatcccgaaagaccagctgatcgat
cagaacctcaacatcatgtaccgccagatgatttcgggagctaggaaggcggagctgttc
atggggcagccgtaccgcgccggcgaccagccggagccgggggcgggcaccgtcgagagc
gtgccgcacaaccccgtccacagatggaccggcgacccgaggcagccgaacggcgaggac
atgggcatcttctactcggcggcgcgcgacccggtgttcttcgcgcaccacggcaacgtc
gaccgcatgtggcacatccgccgcggcctcctcttccccggcgacaccgacttcaccgac
cccgactggctcgacgccagcttcttcttctacgacgaggaggcccgcctcgtccgcgtc
cgcgtccgcgacaccctcgacccgtcggcgctgcgcttcacgtaccaggacgtgggtctc
ccgtggctgaacgccaagccgtccacgggagcagccagcacgccggcgcccgcggccggc
gcgttcccggcgaccctggacaagaccgtgcgggtggccgtgacgaggcccagggcgtcg
aggagccgcgaggagaaggaggaggaggaggaggtcgagatccccgaccactccacgtac
gtcaagttcgacgtgttcgtgaacgcgcccgagagcggggacggcgcggcgacgtgcgcg
gcgacgtgcgccggcagcgtcgcgctggcgccgcacgggatccaccgcgaggggcagctg
tcgccgaggaagacggaggcgaggttcggcatatgcgacttgctggacgacatcggcgcc
gacggcgacaagacgatcgtcgtgtcgatcgtgccgaggtgtggctgcgattcggtcacc
gtcgccggcgtcagcatcggctacgctaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271853
Entry
9271853           CDS       T01015                                 
Name
(RefSeq) aureusidin synthase
  KO
K00422  polyphenol oxidase [EC:1.10.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00950  Isoquinoline alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    9271853
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    9271853
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.1  catechol oxidase
     9271853
SSDB
Motif
Pfam: PPO1_KFDV Tyrosinase PPO1_DWL
Other DBs
NCBI-GeneID: 9271853
NCBI-ProteinID: XP_015633206
UniProt: Q7F4S6
LinkDB
Position
1:complement(33600996..33605400)
AA seq 575 aa
MANERCRVALFVLIVCAFAYAAVYTSSPAVSVNPCAQTLTRALLAVTGLDPYVVSCAADD
GVSTPLLSDGGHDKINAGRVGGPIVTDLLQCRKPEGPDFPEDLQCCPPMPTSEPIDFTLP
DPSEPLRTRRPAHVAGAEYMAKYERAIALMKALPRSDPRSFYQQAHIHCAYCTGAYRQVG
HPELAVQVHFSWLFFPFHRAYLYFFERIAGKLLGDPGFAVPFWSWDVPEGMRMPLQFANA
SSPLYDQMRNPWHAPPKLVDLDYAMDVVENNYTDDEQIKHNLWIMYKQMISSAPLASLFH
GQPFRAGEASKPGAGTVELQPHNLMHVWVGDLLSYPNAEDMGAYYAAGRDPIFYTHHANI
DRLWDVWRSNGKGEDFTDPDWLDSSFLFYDEEARLVRITVRDVLDMDKLRYTYRGVGLPW
LDARPPTTPNVKYRVKNRVEKPVMFPVSLGNVVTAEVRRPLMLWRQPKGATQEEVLVVEH
IQTDGVCKFDVFVNAREHKKIEPCGREMVGSFVCLRHHNTQNNVTRRGVQTTMRVALNDI
LKDLGAEQDESVTVTLVPRHGKVRIGGVRIEYNGM
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggccaacgagcgatgtcgtgttgcgctcttcgtcctcatcgtttgcgccttcgcctac
gccgctgtctacacctcctcgcctgcagtctccgtgaacccatgcgcccaaactctgaca
agggccctcctcgccgtcaccgggctagacccgtacgtcgtctcctgcgccgccgacgac
ggcgtctcgacccccctgctctccgacggcggtcacgacaagatcaacgccggccgcgtg
ggcgggcctattgtcactgacctcctgcagtgccgaaaaccggagggtccagatttcccg
gaggacctccaatgctgcccgccgatgcccacgtccgaaccaatcgatttcacgctcccc
gacccgagcgagccgctccggacgcggcggccggcgcacgtagccggcgcggagtacatg
gccaagtacgagcgcgcgatcgcgctgatgaaggcgctgccgcggagcgacccgcgcagc
ttctaccagcaggcgcacatccactgcgcctactgcaccggcgcgtaccggcaggtcggc
cacccggagctggccgtccaggtgcacttctcctggctcttcttcccgttccaccgcgcc
tacctctacttcttcgagcgcatcgccgggaagctgctcggtgaccccgggttcgcggtg
ccgttctggagctgggacgtgccggaggggatgcggatgccgctgcagtttgccaacgcg
tcgtcgccgctgtacgaccaaatgaggaacccgtggcacgcgccgcccaagctcgtggac
ctggattacgccatggacgtcgtggagaacaactacaccgacgatgagcagataaagcac
aacctctggatcatgtacaagcagatgattagcagtgcgccgttggcctccttattccac
ggccaaccttttcgtgcaggtgaggctagcaagccaggtgcgggaaccgtggagctacaa
ccacataacttgatgcatgtttgggttggcgacttattgtcttatcccaacgccgaggat
atgggagcttactacgccgctggtcgtgacccgatcttctacacgcatcatgctaacatc
gatcggctgtgggatgtatggcgcagcaatggcaaaggcgaagactttacggaccctgat
tggctcgactcctcgtttctcttctacgatgaggaggcccgtcttgtgcgcatcaccgtc
cgtgacgtgctcgacatggacaagctccgatacacgtatcgtggcgttggtttaccatgg
ttggatgcacggccacccactactcccaacgtgaagtacagagtgaaaaacagggtcgag
aagcccgtcatgtttccagtatcccttggcaatgtggtgaccgcagaggtgagacgaccg
ctaatgttgtggagacagccaaaaggggcaacacaagaggaggtgctggtggtcgagcac
atccagacagatggcgtgtgcaagtttgatgtgtttgtcaatgctagggagcacaagaaa
atcgagccatgtggacgggagatggtcgggagctttgtgtgtttaaggcatcacaacacg
caaaacaatgtgacacggagaggggtacaaaccaccatgagggtggcactgaatgatatc
ttaaaggacctaggtgccgagcaagatgagagtgtgactgtgactttggtgccaagacat
ggaaaggttaggatcggaggcgtgagaatagaatacaatggaatgtga

DBGET integrated database retrieval system