KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337100
Entry
4337100           CDS       T01015                                 
Name
(RefSeq) anthocyanidin reductase
  KO
K08695  anthocyanidin reductase [EC:1.3.1.77]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00941  Flavonoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4337100
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.77  anthocyanidin reductase [(2R,3R)-flavan-3-ol-forming]
     4337100
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NmrA NAD_binding_4 Polysacc_synt_2 adh_short DUF1731 KR RAWUL RmlD_sub_bind
Other DBs
NCBI-GeneID: 4337100
NCBI-ProteinID: XP_015637098
UniProt: Q0J9U6 A0A0P0WF57
LinkDB
Position
4:32085520..32088331
AA seq 344 aa
MSAVERKTACVTGGNGYIASALIKMLLEKGYAVNTTVRNPDDMAKNSHLKDLQALGPLKV
FRADMDEEGSFDDAIAGCDYAFLVAAPMNFNSENPEKDLVEAAVNGTLNAMRSCAKVGTV
KRVIITSSDAAISRRPLQGDGYVLDEESWSDVDYLRTEKPPAWAYSVSKVLLEKAACKFA
EENNMSLVTVFPVFTLGAAPAPVARTSVPGILSLLSGDETHLEVLKPLQWVTGSVSIVHV
DDLCRAEIFLAEKESSSLSSAESSARYICCSFNTTVLALARFMAGRYPQYNVKTDRFDGM
PEKPRVCCSSEKLIREGFEFKYTNMGDILDDLVEYGRALGILPH
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtcggcggtcgagaggaagacggcgtgcgtcaccggcggcaacgggtacatcgcttct
gcgctcatcaagatgctgttggagaagggatatgctgtcaacacgacggtcagaaacccc
gatgacatggcgaagaactcccacctcaaggacttgcaggcacttggccccttgaaggtc
ttccgcgccgacatggacgaagaaggaagcttcgacgatgccatcgccggctgcgactac
gccttcctcgtcgccgctccgatgaacttcaattcagagaatcctgagaaagatctggtt
gaagccgccgtcaatggaacgctcaacgcgatgagatcgtgcgcgaaagtagggacggtg
aagcgcgtgatcataacatcgtcggacgcagcgatctccagaaggccgctgcaaggcgac
gggtatgtgctggacgaggagtcctggtctgacgtcgactacctgagaacagagaagccg
ccagcctgggcgtacagtgtgtccaaggtgcttttggagaaggccgcatgcaagttcgcg
gaggagaacaacatgagcctcgtcaccgtgttcccggtgttcaccttgggcgcagcgccg
gcgccggtggcgaggacgagcgtccccggcatcctctccttgctatccggtgatgagacg
catctcgaagtcctgaagcccctgcagtgggtcaccggctccgtgtcgatcgttcacgtc
gacgacctctgccgcgccgagatattcctcgccgagaaggagtcatcgtcattgtcgtcg
gcagagtcgtcggcgaggtacatctgctgcagcttcaacaccaccgtcttggcgcttgcc
cgtttcatggccggaaggtacccgcagtacaacgtcaaaaccgaccgcttcgacgggatg
cctgagaaaccgagagtctgctgttcgtcggagaagctgatcagggaagggttcgagttc
aagtacacgaatatgggcgacatactcgatgaccttgtagagtacggcagggccctggga
attctaccacattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337101
Entry
4337101           CDS       T01015                                 
Name
(RefSeq) anthocyanidin reductase
  KO
K08695  anthocyanidin reductase [EC:1.3.1.77]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00941  Flavonoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4337101
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.77  anthocyanidin reductase [(2R,3R)-flavan-3-ol-forming]
     4337101
SSDB
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NmrA NAD_binding_4 Polysacc_synt_2 KR adh_short DUF1731 RmlD_sub_bind
Other DBs
NCBI-GeneID: 4337101
NCBI-ProteinID: XP_015637099
UniProt: Q5JQX5
LinkDB
Position
4:32090798..32093174
AA seq 337 aa
MSAVGMKTACVTGGNGYIASALIKMLLQKGYAVNTTVRNPDDMRKNSHLKGLEALGTLKV
FRADLDEDGSFDEAVNGCDYAFLVAAPVNLQSENPEKEMIEAGVQGTLNVMRSCLRAGTV
KRVILTSSAAAVALRPLQGGVGHVLDESSWSDVDYLTREKPPSWAYGVSKVLLEKAACKF
AEENDISLITVLPVFTLGAAPTPLTTTSIPTTLSLLSGDEAQLKTLKGLAATGSIPVVHV
DDVCRAEIFLAEKESASGRYICSSLSTTVMALARFAAAKYPQYNVQTDCFEGFPEKPRVC
YSSEKLTREGFEFKWTDLDEIFGDLVEYGKALGILPH
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgtcagcggttgggatgaagacggcgtgcgtgaccggcgggaacgggtatatcgcttcg
gcgctcatcaagatgctgcttcagaagggatatgctgtcaacacgacagtcagaaaccct
gatgacatgaggaagaattcccatctcaaggggttggaggcactaggcaccttgaaggtc
ttccgtgccgaccttgacgaagatggcagcttcgatgaagccgtcaacggctgcgattac
gccttcctcgtcgccgctccggtgaatctccagtcagagaatcctgagaaagagatgatt
gaagccggcgtccaaggaaccctgaacgtgatgagatcgtgcctgagagccggcacggtg
aagcgcgtgattctgacatcgtcggcggccgccgtcgccctccgtccgctgcaaggcggc
gtcggccatgtcctggacgagtcgtcctggtccgacgtcgactacctgacgagagagaag
ccaccatcttgggcgtatggtgtctcgaaggtgcttttggagaaggcggcgtgcaaattc
gcggaggagaacgacatcagcctcatcaccgtgctcccggtgttcaccttgggcgcggcg
ccgacgccgttgaccacaacaagcatcccaactacgctctccttgctgtctggtgatgag
gcgcagctaaaaaccctgaaaggcctggcggccaccggctccattccggtggttcacgtg
gacgacgtctgccgcgccgagatattcctcgcggagaaggagtcggcgtcggggaggtac
atctgcagcagcctcagcaccaccgtgatggcgctcgcacgtttcgcggcagcaaaatac
cctcagtacaacgtccaaaccgactgtttcgaagggttccctgagaagccgagagtgtgc
tattcgtcggagaagctgacgagggaagggttcgagttcaagtggacggatctggacgag
atattcggcgacctcgtcgagtacggcaaggccctggggattctaccgcactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337102
Entry
4337102           CDS       T01015                                 
Name
(RefSeq) anthocyanidin reductase isoform X1
  KO
K08695  anthocyanidin reductase [EC:1.3.1.77]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00941  Flavonoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4337102
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.77  anthocyanidin reductase [(2R,3R)-flavan-3-ol-forming]
     4337102
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NmrA NAD_binding_4 adh_short Polysacc_synt_2 KR RmlD_sub_bind DUF1731 F420_oxidored
Other DBs
NCBI-GeneID: 4337102
NCBI-ProteinID: XP_015635209
UniProt: A0A0P0WFB9
LinkDB
Position
4:32131857..32135576
AA seq 336 aa
MSAVEMKTACVTGGNGYIASALIKMLLQKGYAVNTTVRNPDDMKKTSHLKDLEALGPLEV
FRADMDEEGSFDDAVAGCDYAFLVAAPVNFQSQNPEKELIEAGVQGTMNVMRSCVRAGTV
KRVILTSSAPAVSGRPLQGDGHVLDEDSWSDVEYLTKEKPPAWAYSVSKVLMEKAACKLA
EENNISLITVFPVFTLGAAPTPTAATSVSAMLSLLSSDETQLKTLKGLAATGPIPTVHVD
DLCRAEVFVAEKESASGRYICSSLSTTVVAFARFVAGKHPRYNVKTDGFQGFPEKPRVCY
SSEKLVREGFEFKWTDLDEVFDDLIEYGKVLGILPQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgtcagcggttgagatgaagacggcgtgcgtgaccggcgggaacgggtatatcgcttcg
gcgctcatcaagatgctgcttcagaagggatatgctgtcaacacgacggtcagaaaccca
gatgacatgaagaagacttcccatctcaaggacttggaagcactaggccccttggaggtc
ttccgcgctgacatggacgaagaaggcagcttcgacgatgccgttgccggctgcgattac
gccttcctcgtcgccgctccggtgaatttccagtcacagaatcctgagaaagagcttatt
gaagccggcgtccaaggaaccatgaatgtgatgaggtcgtgcgtgagagccggcacggtg
aagcgcgtgatcctcacatcgtcggcgcccgccgtctccggcaggccgctgcaaggcgac
ggccatgtcctggacgaggattcctggtccgacgtcgagtacctgacgaaagagaagcca
ccagcttgggcgtatagtgtctcaaaggtgctcatggagaaggcagcatgcaaattagcg
gaggagaacaacatcagcctcatcaccgtgttcccggtgttcactttgggtgcagcgccg
acgccgacggccgcaacaagcgtctcagctatgctctccttgctatctagtgatgagacg
cagctaaaaaccctgaaaggcctggcagcaaccggccccattccgacagttcacgtggac
gacctctgccgcgccgaggtattcgtcgccgagaaggagtcggcgtcggggaggtacatc
tgcagcagcctcagcaccaccgtcgtggcattcgcccgtttcgtggcaggaaagcaccct
cggtacaacgtcaaaactgacggcttccaagggttccctgagaagccgagagtgtgctat
tcgtcggagaagctggtgagggaagggttcgagttcaagtggacggatctggacgaggta
tttgacgacctcatcgagtatggcaaggtcctggggattctaccgcaatga

DBGET integrated database retrieval system