KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337230
Entry
4337230           CDS       T01015                                 
Name
(RefSeq) D-3-phosphoglycerate dehydrogenase 3, chloroplastic
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4337230
   00270 Cysteine and methionine metabolism
    4337230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337230
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     4337230
    1.1.1.399  2-oxoglutarate reductase
     4337230
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4337230
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh PGDH_inter IlvN ACT AdoHcyase_NAD NAD_binding_2 F420_oxidored AlaDh_PNT_C XdhC_C UDPG_MGDP_dh_C
Other DBs
NCBI-GeneID: 4337230
NCBI-ProteinID: XP_015635449
UniProt: A0A0P0WFN9 Q7XMP6
LinkDB
Position
4:33167060..33169895
AA seq 613 aa
MAAPSQTTATTTHHRVLLPSHHHHRAVPPSLLRLPLRAARRGRLSAAAAAAAPAASTAAP
SEPAAGAVPGKPTVLVAEKLGAAGLELLRGFANVDCSYGLSPEELRAKIPLCDALIVRSG
TKVGRDVFEASGGRLRVVGRAGVGIDNVDLAAATEHGCLVVNAPTANTVAAAEHGIALLT
AMSRNIAQADASLKAGKWQRNKYVGVSLVGKTIAILGFGKVGSEVARRAKGLGMHVIAHD
PYASADRAHAIGVELVSMEDALTTADFISLHMPLTPATNKMLNDETFAKMKKGVRIINVA
RGGVIDEDALVRALDSGIVAQAALDVFTKEPPAPDSKLVLHENVTVTPHLGASTVEAQEG
VAIEIAEAVIGALKGELAASAVNAPMVPAEVLSELAPYVVLAEKLGRLAVQLVAGGGGIK
SVKVTYASARAPDDLDTRLLRAMITKGLIEPISSVFVNLVNADFTAKQRGVRITEERILL
DGSPETPIDYIQVHIAHVESKFPSAISESGEITVEGKVKDGIPHLTKVGSFQVDVSLEGS
LILCRQVDQPGMIGAVGSVLGEENVNVSFMSVGRIAPRKHAVMAIGVDEEPKKSTLTKIG
EIPAIEEFVFLKL
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggcggcgccgtcccagaccaccgccaccaccacccaccaccgcgtcctcctcccgtcc
caccaccaccaccgagcggtgcctccctcgctcctccgcctcccgctccgcgccgcgcgc
cggggccgcctctccgccgccgccgcggccgcggcgcccgccgcgtcgaccgcggcgccg
tcggagcccgccgcgggtgccgtaccggggaagccgacggtgctcgtggccgagaagctc
ggcgccgcggggctcgagctgctccgggggttcgccaacgtggactgctcctacggcctc
tcccccgaggagctccgcgccaagatcccgctctgcgacgcgctcatcgtgcggtcgggg
accaaggtggggcgcgacgtgttcgaggcatccgggggaaggctccgcgtcgtggggcgc
gccggggtcgggatcgacaacgtcgatctcgccgccgccaccgagcacgggtgcctcgtc
gtcaacgcacccacggcgaacaccgtcgccgcggccgagcacggcatcgcgctgctcacc
gctatgtccaggaacatcgcccaggccgacgcgtcgctcaaggctggtaaatggcagcgc
aacaagtatgtgggtgtatctctcgttggtaaaactattgcaattcttggatttggaaag
gttgggtcagaagtcgctcgtcgtgctaaaggtttgggaatgcatgtgattgcacacgat
ccgtatgcttctgctgatcgtgcccatgcaattggagttgagctagtgagcatggaagac
gctttgacaactgctgactttatctcgttgcatatgcctcttacccctgcaacaaacaag
atgctcaatgatgaaactttcgctaagatgaagaagggtgttagaattataaatgttgcg
cgtggtggtgtaattgatgaagatgctctagtcagggctcttgattcaggaatagttgca
caggctgctcttgatgtgttcactaaagagccaccggcaccagacagcaaattagtgctg
catgagaatgttactgtaacaccacaccttggtgccagcacagttgaagcacaggaagga
gtggctattgaaatagctgaagctgttattggagctctgaaaggggaacttgcagcttca
gcagtcaacgcaccaatggttcctgctgaggtgctgtcagagcttgcaccttatgttgtg
ctcgcagagaagcttgggcgcctggctgtgcagctagtggctggtggcggtggtatcaag
tccgtgaaagtgacctatgcttctgcaagggctcctgatgatcttgacacgagacttctt
cgtgcaatgatcaccaaggggttgatcgaaccaatctccagtgttttcgtcaatctggtc
aatgctgacttcactgcgaaacagaggggagttcgtatcactgaggagagaatcttgttg
gatggctcacccgagacacctattgactacatccaagttcatattgcccatgttgagtcc
aaatttcccagtgcaatatcggagagtggagagatcactgttgaggggaaggtgaaggat
ggcatcccccatctgacaaaggttggatcattccaggttgatgtgagcttggaaggaagc
ctgatcctttgcaggcaggtcgatcaacctggtatgatcggcgcagtaggaagtgtcctt
ggtgaggagaatgttaatgtcagtttcatgagtgttggaagaatcgctcctcgcaagcat
gccgtcatggcgattggtgttgatgaggaacctaaaaagagcacactgacaaagattggg
gagattccggcgattgaagaattcgttttcctcaagctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341713
Entry
4341713           CDS       T01015                                 
Name
(RefSeq) D-3-phosphoglycerate dehydrogenase 3, chloroplastic
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4341713
   00270 Cysteine and methionine metabolism
    4341713
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341713
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     4341713
    1.1.1.399  2-oxoglutarate reductase
     4341713
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4341713
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh PGDH_inter ACT IlvN AdoHcyase_NAD
Other DBs
NCBI-GeneID: 4341713
NCBI-ProteinID: XP_015641367
UniProt: A3BE72
LinkDB
Position
6:complement(26854885..26858659)
AA seq 613 aa
MALAPPLCHLLAAPPPSTSAAADAAHDHAGALAPHRRASPLRRRGRLFLACRVPAAAPSA
RGVAAEAAAGRPTVLVTEKLGDAGLELLRRFANVDCAYELTAEELRAKVSLVDALVVRSA
TRVTREVFEAARGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEHAIALLA
AMARNVAQADASLKAGKWQRNKYVGVSLVGKTLAIMGFGKVGSEVARRAKGLGMDIISHD
PYAPVDRARAIGVDLVSFDEAISTADFISLHMPLTPSTAKLFDDETFANMKKGVRIINVA
RGGVVDEDALLRALDNGTVSQAALDVFTEEPPPKDSKLVHHEHVTVTPHLGASTSEAQEG
VALEIAEAVLGALKGELAATAVNAPMVPAEVLSELSPYVILAEKLGRLVVQLVAGGSGIK
GVKIGYSSSRDPDDLDTRVLRAMVTKGIIEPISSAFVNIVNADYVAKQRGLRISEERILL
DGSPEIPIDSIQVHLANVESKFAGALSDEGDIRVEGEVKDGKPHLTLVGPFSVDVSLEGN
LILCRQVDQPGIIGKVGSILGKMNVNVNFMSVGRTAPGKQAIMAIGVDEEPEKEALKLIG
DIPSVEEFVFIKL
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggcgttggcgccgccgctctgccacctactcgccgcaccgccgccgtccacgtccgcc
gcagccgacgcggctcacgaccacgcgggagccctggccccacaccgccgcgcctccccg
ctccgccgccgcggccgcctcttcctcgcctgcagggtccccgctgctgcgccctccgcc
cgtggggtcgcggcggaggcggcggcgggaaggccgacggtgcttgtgacggagaagctg
ggcgacgcggggctggagctgctgcggaggttcgcgaacgtggactgcgcgtacgagctc
acggcggaggagctccgcgccaaggtgtcgctcgtggacgcgctcgtggtgcgcagcgcc
acgcgggtgacgcgggaggtgttcgaggccgcgcgcggccgcctccgcgtcgtcggccgc
gccggggtcggcatcgacaacgtcgacctccaggccgccaccgaggccgggtgcctcgtc
gtcaacgcccccaccgccaacaccgtcgccgccgccgagcacgccatcgccctcctcgcc
gccatggcgcgcaatgtcgcccaggccgacgcctccctcaaggccggcaaatggcaacgt
aacaaatatgttggtgtttctttggtgggaaagacgctagctattatgggctttgggaag
gttggctcagaagtagcacgacgcgcgaaaggacttggaatggatatcatttctcatgat
ccctatgctcctgttgatagagcccgggcaattggtgtagaccttgtatcgtttgatgag
gccatctccactgcagacttcatatcactgcatatgccacttacaccatcaacagcaaag
cttttcgatgatgaaacttttgcaaacatgaaaaaaggtgtgaggattattaacgttgca
aggggtggggtagttgatgaagacgcgttgctgagagcactcgataatggaacagtttca
caggcagcacttgatgtattcactgaggagccaccaccaaaagacagcaagttagtacac
catgaacatgtgactgtcactccacaccttggagctagtacatcagaagcacaggaaggt
gtagcccttgaaattgcagaggctgttcttggagcactgaaaggggaattagctgctact
gctgttaatgccccgatggtccctgctgaggttttatcggagttatctccgtatgttatc
cttgctgagaaactaggtcggcttgtcgtgcaacttgtagctgggggaagtgggattaag
ggagtgaagattggatattcatcatctcgagaccctgatgatctggacacaagggtactc
cgtgctatggtcaccaaaggcatcatcgagcccatttcaagtgcatttgttaacattgtc
aatgctgactatgtggccaagcaaagaggccttcgcatcagcgaagagagaatcctcctt
gatggatcaccggagattcctatagattctatccaggtgcatctcgccaatgtagagtcc
aagttcgccggtgccctctctgacgaaggtgacatcagagtggagggagaggtgaaggat
gggaaaccacatctcacacttgttgggccattcagtgtggatgttagtcttgagggcaac
ctaatactctgccgtcaagttgatcagccaggtatcattggaaaggtaggatcaattttg
gggaagatgaatgtgaatgtgaatttcatgagcgttggaaggactgctcctggaaagcag
gcgataatggccattggggttgatgaggagcctgagaaggaagctctcaagttgatcggc
gacataccatcagttgaggagtttgtctttattaagctttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345710
Entry
4345710           CDS       T01015                                 
Name
(RefSeq) D-3-phosphoglycerate dehydrogenase 1, chloroplastic
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4345710
   00270 Cysteine and methionine metabolism
    4345710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4345710
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     4345710
    1.1.1.399  2-oxoglutarate reductase
     4345710
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4345710
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh PGDH_inter ACT IlvN AdoHcyase_NAD XdhC_C NAD_binding_2
Other DBs
NCBI-GeneID: 4345710
NCBI-ProteinID: XP_015650533
UniProt: Q6ZCT8 Q6ZAA5
LinkDB
Position
8:complement(21818085..21823213)
AA seq 621 aa
MATAAAASRAALSRPHAAAAAARASPAAGARVTLPRRRSVRSAVISSSASAAAVAASEPA
AGRVTLGAGTDGALWPKPAVLVAEKLSEAGLAVLRGFADVECAYGMSPAELLAKVAQFDA
LIVRSGTKVTREVLEAGRGRLRVVGRAGVGIDNVDLQAATEAGCLVVNAPTANTVAAAEH
GIALLASMARNVSQADAALKAGKWQRTKYVGVSLVGKTLAVMGFGKVGSEVARRAKGLGM
HVIAHDPYAPADRARAIGAELVSFDEAIGRADFISLHMPLTPATSKVFNDESFSRMKNGV
RIINVARGGVIDEDALVRALDSGKVAQAALDVFTEEPPAKDSKLVLHENVTVTPHLGAST
VEAQEGVAIEIAEAVVGALRGELAATAVNAPMVPAEVMSELAPYVSLAEKLGKLAVQLVA
GESGGIKGVKVVYTTARGPDDLDTRLLRAMVTKGIVEPVSSTFVNLVNADYTAKQRGLRI
TEERVSHESPAAEAPLESIQVRLSHVQSKFAGAISDGGDIVLEGRVKYGVPHLTVVGPYE
VDVSLEGNLILCRQIDQPGMIGKVGNILGQTNVNISFMSVGRTFRGKQAIMAIGVDEEPD
KETLEHIGHIPAIEEFVFLEL
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggcaaccgccgccgccgcctcacgcgccgccctctcaaggcctcacgccgccgccgcc
gcggcgcgcgcgagccccgccgcgggggcgcgggtgacgctcccgcggcgccgaagcgtc
cgatccgcggtgatctcgtcgtcggcgtccgcggcggcggtggcggcgtcggagccggcg
gcggggagggtgacgctgggcgcggggacggacggggcgctgtggccgaagccggcggtg
ctggtggcggagaagctgagcgaggccgggctggcggtgctgcgcgggttcgcggacgtg
gagtgcgcgtacgggatgtcccccgcggagctcctcgccaaggtggcgcagttcgacgcg
ctcatcgtgcgcagcggcaccaaggtgacgagggaggtgctggaggccgggcgcgggcgg
ctgcgcgtggtgggccgcgccggcgtcgggatcgacaacgtcgacctccaggccgccacc
gaggccggctgcctcgtcgtcaacgcccccaccgccaacaccgtcgccgccgccgagcac
ggcatcgcgctcctcgcctccatggcgcgcaacgtctcccaggccgacgccgccctcaag
gccgggaaatggcaaagaaccaagtacgttggagtttctctggtcgggaagacacttgcg
gtaatgggctttggcaaggttggttcagaggtagccaggcgggcgaaagggctcggtatg
catgtgattgctcatgatccgtacgcccctgccgatagggctcgtgccattggagctgaa
ctggtctctttcgatgaggccattggcagagccgacttcatctcccttcacatgcctctc
accccagcaacatccaaggtcttcaacgacgaatccttttctaggatgaagaatggagtt
cggatcatcaatgtggccaggggtggagtgatcgacgaagatgctcttgtcagagccctt
gactctggcaaagttgctcaggcagcccttgatgtcttcactgaggagcccccagccaag
gacagcaagctagtcctccatgagaatgttactgttacaccccatcttggagcaagtaca
gtggaggcccaggagggcgtcgctatcgagatagccgaagctgtcgtcggtgcactgaga
ggtgagctcgcagcaacagccgtgaatgctcccatggtcccagctgaggtcatgtcagag
cttgccccgtatgtttcactggcagagaagctgggcaagctggcggtgcagctcgtcgca
ggcgagagcggcggcatcaagggcgtcaaggtggtgtacaccacggcccgtggcccggac
gacctcgacacgaggctcctccgcgccatggtgaccaagggcatcgtggagcccgtgtcg
agcacgttcgtcaacctggtgaacgccgactacacggcgaagcagcgcggcctgcgcatc
accgaggagcgggtctcccacgagagccccgccgcggaggcgccgctggagtccatccag
gtgaggctctcacacgtccagtccaagttcgccggcgccatcagcgacggcggcgacatc
gtcctcgaggggagggtcaagtacggcgtgccgcacctcaccgtcgtcgggccctacgag
gtggacgtcagcctggagggcaacctgatcctgtgccggcagatcgaccagcccggcatg
atcggcaaggtcggcaacatcctcggccagacgaacgtcaacatcagcttcatgagcgtc
ggccggaccttccgcggcaagcaggccatcatggccatcggcgtcgacgaggagcccgac
aaggagaccctcgagcacatcggccacatcccggcgatcgaggagttcgtcttcctcgag
ctatga

DBGET integrated database retrieval system