KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337361
Entry
4337361           CDS       T01015                                 
Name
(RefSeq) protein DJ-1 homolog D isoform X1
  KO
K18881  D-lactate dehydratase [EC:4.2.1.130]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4337361
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4337361
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.130  D-lactate dehydratase
     4337361
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C56: PfpI endopeptidase family
   4337361
SSDB
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase SNO GATase_3 Peptidase_C26 Catalase_C
Other DBs
NCBI-GeneID: 4337361
NCBI-ProteinID: XP_015633441
LinkDB
Position
4:complement(34267858..34270894)
AA seq 423 aa
MAPKKVLLLCGDYMEDYEAMVPFQALQAYGVSVDAACPGKKAGDSCRTAVHQGIGHQKGE
RKGEYTQSHNGTGKTYVQLGLFLRAHNEMTDFLTYAESRGHNFALNASFDEVNINEYDGL
VIPGGRAPEYLAMDEKVLDLVRKFSDAKKPIASVCHGQLILAAAGVVQNRKCTAYPAVKP
VLVAAGAKWEEADTMDKCTVDGNLVTAVAYDAHPEFISLFVKALGGSVTGSNKRILFLCG
DYMEDYEVMVPFQSLQALGCHVDAVCPDKGAGEKCPTAIHDFEGDQTYSEKPGHDFALTA
SFDNVDASSYDALVIPGGRAPEYLALNDKVISLVKGFMDKAKPVASICHGQQILSAAGVL
QGRKCTAYPAVKLNVVLGGATWLEPNPIDRCFTDGNLVTGAAWPGHPEFISQLMALLGIK
VSF
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggctcccaagaaggtgctcctgctctgcggagactacatggaggactacgaggccatg
gttccgttccaagcgctgcaagcgtacggggtgtccgtggatgctgcctgccccggcaag
aaggccggcgactcgtgccgcaccgccgtccatcaggggattggccaccagaagggggaa
agaaaaggagagtacacacagtcacacaacgggacagggaaaacatatgtgcaactaggt
ttatttttgagagctcataatgaaatgacagatttcttgacatatgctgagtcaaggggc
cacaatttcgcacttaatgcttcgtttgatgaggttaatatcaatgaatatgatggcttg
gtaattcctggaggccgtgcaccagagtatctcgccatggatgaaaaggttcttgattta
gtaaggaaattctctgatgcgaagaaacctattgcatcagtttgccatggacagttgatt
ttggcagcagctggagtagtccagaaccgtaaatgcaccgcatatcctgctgttaaacca
gttttggttgctgctggtgctaagtgggaagaagctgatactatggacaaatgcacagtt
gatggaaatcttgtcactgcagtggcttacgatgcacatcctgaattcatcagccttttt
gtgaaagcgcttggaggctctgtaactggctcaaacaaacggatattgttcctttgtggg
gattacatggaagattatgaggttatggtaccatttcagtctcttcaagcccttggttgc
catgttgatgcagtttgccctgacaagggtgctggggagaaatgcccaactgccatacat
gactttgaaggtgaccaaacatacagcgagaagcctggtcacgattttgctttgacagca
tcatttgacaatgtggatgcatcaagctatgatgcacttgtaattcctggtggacgggct
cctgagtaccttgcactgaacgataaagtcattagccttgtgaagggcttcatggataaa
gcaaagccagtcgcctcaatttgccatggccaacagattttatctgctgctggagtcctt
cagggaaggaaatgcacggcgtatcctgcggtgaagctgaacgtggtgcttggcggggcg
acatggctggagcccaatcccattgaccgctgcttcaccgacggcaaccttgtgaccggc
gcggcatggcctggccacccggagttcatctcccagctcatggcattgcttggcatcaag
gtctccttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350819
Entry
4350819           CDS       T01015                                 
Name
(RefSeq) DJ-1 protein homolog E
  KO
K18881  D-lactate dehydratase [EC:4.2.1.130]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4350819
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4350819
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.130  D-lactate dehydratase
     4350819
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C56: PfpI endopeptidase family
   4350819
SSDB
Motif
Pfam: DJ-1_PfpI Glyco_transf_4
Other DBs
NCBI-GeneID: 4350819
NCBI-ProteinID: XP_015615572
UniProt: Q0IRW6 Q2R1V5
LinkDB
Position
11:22491415..22494551
AA seq 396 aa
MAPCKKVLMLCGDYMEDYEAAVPFYALAAFGVAVDCVAPGKKPPGDACLTAVHEFLGHDL
YTELPGHRFAVTADFAAAAAADASRYDALVVPGGRFVERLSVDPLAVSLVAAFAGEGETA
TRRRPVVVTCHSQLLLAAAGAMRGVRCTAFFSMRRVVELAGGTWVEPDPLGLCVADGNVL
SAIGWPAHGEIIRELLRAMGARVAGGRGQAVLFLCADYVDDYEANVPFRALAGVGCRVEA
ACPTKRKGEACVTAIYDATPAAASDERRGHNFAVTADWGDVDADRYACVVVPGGRAPELL
ATRGEAVALVREFAGKGKVVASIDQGHLLLAAVGLLDGRSCASGVATRVVAGLAGAASVR
HGGAVADGKLVTAASWPDLAEFIAHIISLLGITVSF
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggcaccgtgcaagaaggtgctgatgctgtgcggcgactacatggaggactacgaggcc
gccgtgccgttctacgcgctcgccgcgttcggcgtcgccgtcgactgcgtcgcgccgggg
aagaagccccccggcgacgcctgcctcaccgccgtccacgagttcctcggccacgacctc
tacaccgagctcccgggccaccggttcgcggtcaccgccgacttcgccgcggccgccgcg
gctgacgcgtcgcgctacgacgcgctcgtcgtccccggcgggaggttcgtcgagcggctc
agcgtggacccgctcgccgtgtcgctcgtcgcggcattcgccggggagggggagacggcg
acgcgcaggcggccggtggtcgtgacgtgccatagccagctgctgctcgccgccgcgggc
gccatgcgcggcgtcaggtgcacggcgttcttcagcatgcggcgtgtggtggagctcgcc
ggcgggacgtgggtggagcctgacccactcggcctctgcgtcgccgacggcaacgtcctg
agcgccatcggctggcccgcgcacggcgagatcatcagggagctcctccgcgccatgggc
gcccgcgtcgccggcggccgcggccaggccgtcctcttcctctgcgccgactacgtcgac
gactacgaggcgaatgtgccgttccgtgcgctggccggcgtgggctgccgcgtcgaggcg
gcgtgcccgacgaagcgcaagggcgaggcgtgcgtcacggcgatctacgacgccaccccg
gcggcggcgagcgacgagaggcgcggccacaacttcgcggtgaccgcggactggggcgac
gtcgacgccgaccggtacgcgtgcgtcgtcgtgccgggcggccgcgcgccggagcttctg
gcgacgcgcggcgaggccgtggcgctggtgcgcgagttcgccgggaaggggaaggtggtc
gccagcatcgaccagggccacctcctcctcgccgcggtggggctcctcgacggcaggagc
tgcgcgagcggcgtcgcgacgagggtggtcgccggcctcgccggcgcggcgagcgtccgg
cacggtggcgcggtcgccgacgggaagctcgtgacggcggcgagctggcctgacctcgcc
gagttcatcgctcacatcatcagcctccttggcatcactgtctcgttctga

DBGET integrated database retrieval system