KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337389
Entry
4337389           CDS       T01015                                 
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4337389
   00513 Various types of N-glycan biosynthesis
    4337389
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4337389
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4337389
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     4337389
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   4337389
SSDB
Motif
Pfam: STT3 DUF6798
Other DBs
NCBI-GeneID: 4337389
NCBI-ProteinID: XP_015635991
UniProt: Q7XQ88
LinkDB
Position
4:complement(34492165..34496534)
AA seq 721 aa
MAAATALDSLPAPLRSLRLKTKQQELLLRVSALALIYVLAFVVRLFSVLRYESMIHEFDP
YFNYRTTLFLSDHGFSEFWNWFDFESWYPLGRVVGGTLFPGLMVTAALLHRLLRALSLAV
HIREVCVLTAPFFAANTTLVAYAFGREIWDSGAGLVAAALIAVCPGYISRSVAGSYDNEG
VAIFALLLTFYLFVRAVNTGSLAWSLASAFGYFYMVSAWGGYVFIINLLPLYVLVLLVTG
RYSQRLYVAYNSTYVLGMLLAMQIRFVGFQHVQSGEHMAAMGVFFLLQVFFFLDWVKYLL
NDAKLFKSFLRITLTCVITVGTLALGIGTASGYISPWTGRFYSLLDPTYAKDHIPIIASV
SEHQPTAWSSFMFDFHILLFLFPAGLYFCFKRLSDATIFIVMYGLTSMYFAGVMVRLILV
AAPAVCLISAIAASATIKNLTTLIRTKSKSPQTVSGKSSGSKAAAKGAVDQSLPFQQNVA
IALLLGAFYLLSRYAVHCTWVTSEAYSSPSIVLAARGHNGGRVIFDDYREAYYWLRQNTP
SDAKIMSWWDYGYQITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNY
VLVVFGGVTGYSSDDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMY
KLCYYRFGELTTEYGKPPGYDRVRGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR
S
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggccgccgccaccgcgctggactcgctgccggcgccgctccggtcgctgcggctgaag
acgaagcagcaggagctcctgctccgggtctcggcgctggcgctcatctacgtgctcgcg
ttcgtcgtccgcctcttctccgtgctccgctacgagtccatgatccacgagttcgatccc
tacttcaactaccgcaccacgctcttcctctccgaccatggattcagcgagttctggaac
tggttcgatttcgagagctggtacccgctcggccgcgtcgtcggcggcaccctcttcccg
ggcctcatggtcaccgccgcgctgctccaccgcctcctccgcgcgctctccctcgccgtc
cacatccgcgaggtctgcgtcctcaccgcccccttcttcgccgccaacaccacgctcgtc
gcctacgccttcggccgcgagatctgggactccggcgcgggcctcgtcgccgccgcgctc
atcgccgtctgccccggctacatctcccgctccgtcgcgggctcctacgacaacgagggc
gtcgccatcttcgcgctgctgctcaccttctacctcttcgtgcgcgccgtcaacacggga
tctctcgcatggtcgctcgcctcggcgttcggctacttctacatggtctccgcgtgggga
ggctatgtcttcatcatcaatctgttgccgctgtacgtgctcgtgctgctcgtcacgggg
aggtactcgcagaggctctacgtggcctacaattccacgtatgtgcttggaatgctactt
gcgatgcagatccggttcgttgggttccaacacgtccagtctggggagcacatggccgct
atgggagtattcttccttttgcaggttttctttttcttggactgggtgaagtacctgctg
aatgatgccaaactattcaagtcattcctgagaatcaccctgacatgtgtgataactgtt
ggcaccctagctcttggaattggtaccgcgtcaggttacatctccccttggacagggcgg
ttttactccctgcttgatccaacctatgcaaaggaccatataccaatcattgcatcagta
tctgagcatcaaccaacagcgtggtcttcgttcatgtttgatttccacatccttcttttc
ctgttcccagcaggcctctacttctgtttcaagcgcttgtcagatgccacaatatttata
gttatgtatggcctcacgagtatgtactttgctggtgtgatggttcggttaattcttgtt
gcagcgccagctgtttgccttattagtgccattgcagcatcagctacaataaaaaatctg
actaccttgattcggacaaaaagcaaaagtccacaaactgtctctggaaaatcatctggc
tcaaaggcagctgcaaagggtgcagttgatcaatccttgcctttccagcagaatgtggcc
attgctttacttctgggtgctttctacttgcttagtagatatgctgtacactgcacttgg
gtgacatctgaagcttactcttctccttccattgttctggccgcaaggggtcataatgga
ggcagggtcatatttgatgattatcgtgaagcgtattattggcttcgtcagaacactcct
tctgatgcaaagattatgtcatggtgggattatggataccaaatcacagctatggggaac
agaactgttattgttgataacaacacatggaataatacacatatagctacagttgggcgt
gcaatgtcatcctatgaagatgaagcgtatgagataatgcagtcactggatgtgaattat
gtgcttgtcgtatttggtggtgttactggttattcttcagatgacattaacaagttctta
tggatggtgcgcattggtggtggagtttttcctgtaatcaaagagcctgattaccttgtt
aatggggagtatcgtgtcgacaagggggcagcaccaaaaatgttgaattgcttaatgtac
aagctttgttattaccgttttggagaactgaccacagaatatggaaaacctccaggatac
gatcgagtacgaggagtggagattggcaacaaagacattaagcttgagtacttggaggag
gcattcacaacttcgaactggatagtgcgcatatacaaggtcaaacccccgaagaatagg
tcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339345
Entry
4339345           CDS       T01015                                 
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
osa04141  Protein processing in endoplasmic reticulum
Module
osa_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4339345
   00513 Various types of N-glycan biosynthesis
    4339345
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4339345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4339345
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     4339345
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   4339345
SSDB
Motif
Pfam: STT3
Other DBs
NCBI-GeneID: 4339345
NCBI-ProteinID: XP_015639423
UniProt: Q6F2Z1
LinkDB
Position
5:complement(25811203..25817171)
AA seq 787 aa
MAEPESSTAAAGGSRLRNACGGVLCAFTLLLIGVLAFSIRLFSVIKYESVIHEFDPYFNF
RVTQFLSKNGIYEFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWWLLNSLNIPLSVET
VCVFTAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPSYISRSVAGSYDNEAVAIF
ALIFTFYLYVKTLNTGSLFYATLNALSYFYMVCSWGGYTFIINLIPIHVLLCIVTGRYSS
RLYIAYAPLVILGTLLAALVPVVGFNAVMTSEHFASFLVFIILHVVALVYYIKGLLTPRL
FKVAMTLVITVGLAVCFAVIAILIALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSE
HQPPTWPSYFMDINVLAFLIPAGIISCFLPLSDASSFVVLYLVTAVYFSGVMVRLMLVLA
PAACILSGIALSEAFDVLTRSVKYQLSKLFDDSPAASGDSSAESSSASTVSTNSAKNETR
PEKTETAPKEKPSKKNRKKEKEVAESVPVKPKKEKKLLVLPMEASVLGILLLIVLGGFYV
VHCVWAAAEAYSAPSIVLTSRSRDGLHVFDDFREAYAWLSHNTDVDDKVASWWDYGYQTT
AMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPSDDI
NKFLWMVRIGGGVFPHIKEPDYLRDGNYRVDAQGTPTMLNCLMYKLCYYRFVETDGKGFD
RVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKKLKSGSKASSTNAAG
RKKNPWQ
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggcggagcccgagtcctccacggccgcggccggcggcagccgcctccgcaacgcctgc
gggggcgtgctgtgcgccttcaccctcctcctcatcggcgtcctcgcgttctcgatccgc
ctcttctccgtgattaagtacgagagcgtgatccacgagttcgacccctacttcaacttc
cgcgtcactcagtttttgtcgaagaatgggatctacgagttctggaactggtttgatgac
aggacatggtatccccttggccgtgtgattggcggcactgtgtatcctggtttgacattg
acagctggaaccatttggtggttgctaaattctctaaacattccgttgtcagtggagact
gtttgtgtgttcactgctccaatattctcagcaaacgcttcctgggctacttacctttta
acaaaggaagccaaaggcactggggctggattgatggcagcagctattttggcaatggtt
ccctcatacatctcaagatccgttgcaggaagctatgataatgaagccgtagcaatattt
gctttgatattcacattttatctatatgtaaagacactgaacacaggatcactcttttat
gcaacgctcaatgctctctcatatttctacatggtctgttcttggggaggttacacattc
atcatcaaccttattccaattcatgtactgttgtgcattgtcactggtcgttattcttca
cggctttacattgcttatgctccccttgttatactgggaacacttctggcagccttagta
cccgtggttggttttaatgcagtgatgacgtctgagcactttgcatcatttctggtgttc
ataatccttcatgtggttgctcttgtgtattacataaaaggacttctaactcccaggctg
ttcaaagtagctatgactcttgtcataacagttggcttggctgtttgttttgcagtaata
gctatactcatcgctttggtggcatctagccccacaaaaggatggagtgggcgcagtttg
agtctacttgatccaacctatgcaagcaagtacatccctattattgctagtgtcagcgaa
catcaaccccctacctggccctcctatttcatggatatcaacgtgttggccttcttgatt
cctgctgggatcatttcatgcttcttgcctttatctgatgcaagctccttcgtggtcttg
tacttggtcaccgcagtatatttttctggagtaatggtgcggcttatgcttgtccttgct
cctgctgcgtgcattttatctggaatcgctctttctgaggctttcgacgtcctcacaaga
tccgttaaatatcagctatcaaaattatttgatgacagccctgctgcttcaggggatagt
agtgcagagagttctagcgctagtactgtctccacaaattcagcaaaaaatgagactaga
cctgaaaaaactgaaacagccccaaaggaaaaaccatcaaagaaaaaccggaagaaggaa
aaggaagtggctgaaagtgttcctgtaaagcctaaaaaggaaaagaagcttttggtactt
cctatggaggcatctgttttgggcattttgttgctgatcgtgttaggtggtttctatgtg
gtccattgtgtgtgggcagcagctgaggcgtactcagctccttcaattgtgttgacttct
cgttcgcgtgatggattgcatgtttttgatgatttccgtgaagcctatgcatggctcagc
cataacacagatgttgatgacaaggttgcgtcctggtgggattatggttatcaaacaact
gcaatggccaacaggactgtaattgtagacaataatacttggaataatacccacatagca
acagttggaacagcgatgtcatctccagaaaaagcagcttgggagatcttcaattcttta
gatgtcaaatatgtccttgttgtatttggaggtcttgttggctaccctagcgatgatatt
aacaagttcctttggatggttcgcataggaggtggtgtattccctcacatcaaggaacct
gattatcttagggatggtaactatcgtgttgatgctcaaggcaccccaactatgctgaat
tgcctcatgtacaagctttgctattacaggttcgttgagaccgatggcaaaggttttgat
agagtaagaggatatgaaataggaaagaagcatttcaaactaacacattttgaggaggtt
ttcacaacccaccactggatggtccgtatatataaactgaaacctcaaaagaatagggtt
cggggcaagttgaagaagttgaaatctggctccaaagctagctcaacgaatgcggcgggc
cgaaagaagaacccatggcaataa

DBGET integrated database retrieval system