KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337529
Entry
4337529           CDS       T01015                                 
Name
(RefSeq) jasmonate O-methyltransferase
  KO
K08241  jasmonate O-methyltransferase [EC:2.1.1.141]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4337529
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.141  jasmonate O-methyltransferase
     4337529
SSDB
Motif
Pfam: Methyltransf_7 Methyltransf_23
Other DBs
NCBI-GeneID: 4337529
NCBI-ProteinID: XP_015639512
UniProt: Q0DLH7 Q9FW31
LinkDB
Position
5:complement(116417..118429)
AA seq 373 aa
MMQSAAGAMELLVASQEAGGVVVVGMNSGDAGELSYANNSDMQRTIAAATRKERQEMAAA
VRRGRRQARAIAIADLGCATGPNALLMAGDAVEAMLGDAERQQEAAPAEFHVFLNDLPSN
DFNSVFRQKQKLVVPSNNANSSRCLVSAWPGSFYGRVFPADSLDYVVSSSSLHFLSRAPA
DAAPNEGRMYVSASSSSSSSSRVLHAYRAQFQADFRLFLSCRAEEVRRGGVLLLTFVARR
EAVPSPHDCHLWDLLAEAAADDRRLVDSFDAPFYGPCPEELREAIREEGSFQVTRMELFE
VSRSRSCQSQADLDQLAAQTSSTIRAVVEPMLGPHFGWDAMDALFRRYTHLLHNYYRHNN
DQLTNVFLALHKI
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgatgcagagtgcagctggagcaatggagctgctggtggcgtcgcaagaagcaggcggc
gttgtggtggtgggcatgaacagtggcgacgccggagagctgagctacgccaacaactcg
gacatgcagcggacgatcgctgcggcgacgaggaaggagcggcaggagatggcggcggcc
gttcggcgcggtcggcggcaggcgagagccatagccatcgccgacctcgggtgcgccaca
gggccgaacgcgctgctgatggccggcgacgccgttgaggccatgctgggcgacgcggag
cggcagcaggaggcggcgcctgcagagttccacgtcttcctcaacgatctccccagcaac
gacttcaacagcgtgttccggcagaagcagaagctggtggtgccgagcaataatgccaat
agcagccggtgcctggtgtcggcgtggccggggtccttctacgggcgcgtgttcccggcg
gatagcctggactacgtggtgtcgtcgtcgagcctccacttcctgtctagggcacccgca
gatgcggcgcccaacgaggggaggatgtacgtgtcggcgtcgtcgagctcgagctccagc
tccagggtgctgcacgcctacagggctcagttccaggccgacttccgcctcttcctctcc
tgccgcgccgaggaggtccgccgcggaggcgtcctcctcctcaccttcgtggccaggcgg
gaggcggtgccctcgccgcacgactgccacctctgggacctgctcgccgaggccgccgcc
gacgacaggaggctcgtcgactccttcgacgcgcccttctatgggccctgcccggaggag
ctgagggaggccatccgcgaggaggggtccttccaggtgacgaggatggagctcttcgag
gtgagccgctcccgctcatgccaatcccaagcagatctagatcagctggcggctcagaca
agcagcaccatcagggcggtggttgagcctatgcttggaccacacttcgggtgggacgcc
atggacgccctcttccggaggtacacccacctgctccacaattactaccgccacaacaac
gaccagctcaccaacgtcttcctcgccttgcacaagatttga

DBGET integrated database retrieval system