KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337831
Entry
4337831           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase II subunit 1
  KO
K03006  DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4337831
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4337831
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337831
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     4337831
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     4337831
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4337831
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_6 RNA_pol_Rpb1_7 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_R PspA_IM30
Other DBs
NCBI-GeneID: 4337831
NCBI-ProteinID: XP_015638336
UniProt: Q0DKN9
LinkDB
Position
5:complement(2934462..2944574)
AA seq 1834 aa
MDAARFPYSPAEVAKVEAVQFGVLSPDEIRQMSVVHIEHAETMEKGKPKPGGLSDPRMGT
IDRKIKCETCMAGMAECPGHFGHLELAKPMFHIGFIKTVLSIMRCVCFNCSKILADEDDI
KFKQALKIRNPKNKLKRIYDACKNRKICAGGDNLDVQEQQGTDDPVKKRGGCGAQQPNIT
VDGMKMVAEYKAPKKKNDDQEQLPEPVDRKQILSAERVLNVLKHISDEDCLLLGLNPKFA
RPDWMILQVLPIPPPPVRPSVMMDTSSRSEDDLTHQLAMIIRHNENLRRQERNGAPAHII
TEFAQLLQFHIATYFDNELPGQPRATQRSGRPIKSICSRLKAKEGRIRGNLMGKRVDFSA
RTVITPDPNINIDELGVPWSIALNLTYPETVTPYNIERLKELVEYGPHPPPGKTGAKYII
REDGQRLDLRYVKKSSDQHLELGYKVERHLNDGDFVLFNRQPSLHKMSIMGHRIKIMPYS
TFRLNLSVTSPYNADFDGDEMNMHVPQSFETRAEVLELMMVPKCIVSPQSNRPVMGIVQD
TLLGCRKITKRDTLIEKDVFMNILMWWEDFDGKVPAPAILKPRPIWTGKQVFNLIIPKQI
NLIRFSGWHSEAETRFITPGDTMVRIEKGELLSGTLCKKTLGTSTGSLIHVIWEEVGPDA
ARKFLGHTQWLVNYWLLQNGFSIGIGDTIADAATMENINETISKAKNDVKKLIKQFRDNQ
LEAEAGRTTMESFENRVNEVLNKARDVAGSSAEKSLSESNNLKAMATAGSKGTFINISQM
TACVGQQNVEGKRIPFGFTNRTLPHFTKNDYGPESRGFVENSYLRGLTPQEFFFHAMGGR
EGLIDTAVKTSETGYIQRRLVKAMEDIMVKYDGTVRNSLGDVIQFLYGEDGMDAIWIESQ
KLDSLKMKKAEFDNVFRYELDDENWKPNYLSTQHAEDLKTISEIRNVFEAEVQKLEADRF
QLGTEIATTGDNTWPMPVNLKRLIWNAQKTFKIDLRRPSDMHPMEIVDAIDKLQERLKVV
PGDDDISIEAQKNATLFFNILLRSTFASKRVLKEYRLTKEAFEWVIGEIESRFLQSLVAP
GEMIGCVAAQSIGEPATQMTLNTFHYAGVSAKNVTLGVPRLREIINVAKNIKTPSLSVHL
KPEVNKKKELAKNVQCALEYTTLRSVTHATEIWYDPDPLGTIIEEDAEFVQSYYEMPDED
IDPDKISPWLLRIELNREMMVDKKLSMADIAEKINHEFDDDLSCIFNDDNADKLILRVRI
TNDEAQKGEIQDEYGEDDVFLKKIESNMLTEMALRGIPGINKVFIKEGNVNKFEDNDGFK
TEKGWMLDTEGVNLLAVMCHEDVDATRTTSNHLIEVIEVLGIEAVRRALLDELRVVISFD
GSYVNYRHLAVLCDTMTYRGHLMAITRHGINRNDTGPLMRCSFEETVDILLDAAVYAESD
PLRGVSENIMLGQLAPIGTGGCDLYLNDQMLKQAIELQLPSYVEGLDFGMMTSACSPISG
TPYHQGMMSPSYLLSPDIRASPTAADAQFSPYVGGMAFSPVSSPGNYTPSSGGGYSPSPP
VCTPGPGSFTSSSPYNPVSPFYSPASPLSCPLTSPSYVPTSLPHSPTSPIYSATSPIYSP
SSPIYSPTSLSYSPTSPVYSPTSPVYNPTSSAYSPTSPSYNPTSPSYSYSPTSPSYSPTS
PSYSYSPTSPSYSPTSPSYNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
SAYSPTSPAYSPTSPGYSPTSPSYSPSSPSYNPSSVKYTPSHAYSPSSPNYYSSTSPTYS
PTSPSYSQPSPSYSPTSRVEEEAHEEAEEEEPKR
NT seq 5505 nt   +upstreamnt  +downstreamnt
atggatgctgcgaggttcccgtactcgccggccgaggtggccaaggtggaggcggtgcag
ttcggcgtcctcagccccgacgagatcagacaaatgtcggtggtgcatatagagcatgca
gagactatggaaaaggggaagcccaagcctggtggcttgagtgaccctcggatggggaca
attgaccggaagatcaagtgtgagacatgcatggctgggatggcagagtgcccaggccac
tttggccaccttgagcttgctaagccaatgttccacatcggcttcatcaagactgtactc
tccataatgcgctgcgtctgcttcaattgctccaagatccttgcagatgaggatgatatc
aagttcaagcaggctcttaaaatcaggaatccaaaaaataaactaaaaagaatatatgat
gcttgcaagaacagaaagatctgtgcaggcggtgacaatcttgatgttcaggagcaacaa
ggtactgatgatccagtgaagaaaaggggtggctgtggtgctcagcagccgaatatcact
gttgacggtatgaagatggttgcagagtataaagcaccaaagaagaaaaacgatgaccaa
gagcaactccctgaacctgtggaccggaagcaaatcctctctgctgagagggtccttaat
gttcttaaacatataagtgacgaggactgtcttctattgggtctgaaccccaaatttgcc
cgtcctgattggatgattttgcaagtccttccgattcctccaccccctgtgagaccatct
gtaatgatggatacttcttccagaagtgaggatgatttgactcatcaattagcaatgata
attcgacacaatgagaacttgaggaggcaagagagaaatggagccccagctcacataata
acagagtttgctcagttattgcaattccacattgcaacatactttgacaatgaacttcct
ggccagccaagggccacacagcgatctggaaggcctattaaatcaatttgcagcagactg
aaagcaaaggaaggccgcattagaggaaacttgatggggaagcgtgttgatttctcagct
cgtactgtcatcacaccagacccgaatattaacattgatgaattgggagtgccatggagt
attgctttgaacctgacatacccagaaactgttactccatataacatcgagaggttgaaa
gaacttgtagaatatgggccccaccctccccctgggaagacaggtgcaaaatacattatc
agggaagacggtcagaggcttgatcttcgttatgtgaagaaaagtagtgatcagcatctg
gagctgggttacaaggtggaaaggcacctcaatgatggggattttgttcttttcaatcgg
caacccagtcttcacaaaatgtctatcatggggcatcgcattaaaatcatgccctattca
actttccgcttaaacttgtccgtcacttcgccgtacaatgcagattttgatggggatgaa
atgaatatgcatgttcctcagtcatttgagaccagagctgaagttctagagttgatgatg
gttccaaaatgtattgtgtctcctcaatcgaacaggcctgttatgggtattgtccaggac
acgcttcttgggtgtcgcaaaattactaaaagagatactcttattgaaaaggatgtattt
atgaacatcttaatgtggtgggaagattttgatggaaaggtccctgcccccgccattttg
aaaccaaggcctatttggactgggaaacaagttttcaacttaattattcccaagcaaatc
aatttgattagattttctggctggcattctgaagctgaaacaagatttattactcctggt
gatactatggtccggatagagaagggagagcttctatctggtacactttgcaaaaagaca
cttggaacatcaactggaagtcttattcatgttatttgggaagaggttggtccagatgct
gctcgcaagttcttaggtcatacacagtggctagtcaactactggcttctgcaaaatggt
ttcagtattggaattggggatacaattgcagatgcagccaccatggagaatattaatgag
acaatctcaaaagctaaaaatgatgtgaagaaacttattaagcaatttcgtgataaccaa
ttggaagctgaggcaggacgcaccacgatggaatcatttgaaaatagagtaaatgaggtt
cttaacaaggctcgtgatgttgctggaagtagtgccgagaagagtttgtctgaaagtaac
aatctgaaggctatggccaccgcaggctcaaaaggaactttcatcaatatttcacagatg
actgcttgtgtcggacagcagaatgttgagggcaagcggatcccatttggcttcaccaat
cgaacattgccccacttcacgaaaaatgactatggtcctgaaagtcgtgggtttgtggag
aactcttaccttcgaggcctgacaccacaagaatttttctttcatgctatgggtggtaga
gaaggtctgattgatactgctgtgaagacctcggaaactggatatatccagcgacgactt
gtgaaggctatggaagatatcatggtgaagtatgatggtactgttagaaattctttggga
gatgtcattcagttcttatatggagaagatggcatggatgctatttggattgagtcacag
aagttggactccttgaagatgaaaaaggctgagtttgataatgtatttcgttatgaactg
gatgatgagaactggaagccaaactacttgtcgactcaacatgctgaggatttgaagacc
atcagtgagattagaaatgtgtttgaggcagaggttcagaagctagaagctgaccggttc
cagcttggcactgagattgctacaactggtgataatacatggcctatgcctgtcaatctc
aagcggcttatctggaatgctcagaagacattcaagattgatctgagaaggccttctgac
atgcacccaatggaaattgtggatgcaatagataagctgcaagaaagacttaaggttgtc
cctggtgacgatgatatcagtattgaggctcagaagaatgcaactttgttcttcaatatc
ctgcttcgaagcacatttgctagcaagagggtcttgaaggagtacaggcttacaaaggaa
gcttttgaatgggttattggtgagattgaatcgagattccttcaatctttagtggctcca
ggtgaaatgatcggatgtgtagctgcacagtccatcggagaaccagcaactcagatgacc
ctgaatactttccattatgctggtgtcagtgccaagaacgttacccttggtgttcccagg
ctgagagaaatcattaatgttgctaagaatataaaaactccatcattgtcagttcaccta
aagcctgaggtgaacaagaagaaggaattggcgaagaatgtccaatgtgccttagagtac
actactctgcggagtgtgactcatgctactgagatatggtatgatcctgatcctctggga
accattattgaagaagatgctgaatttgtccagtcctactatgaaatgcctgatgaggac
attgaccctgataaaatttctccatggctgctgcgtattgagctgaatcgtgagatgatg
gttgataagaaattgagcatggctgatattgcagagaagatcaatcatgaattcgatgat
gacttgtcatgtatatttaatgatgataatgcagataaactgatccttcgtgtccggatc
acaaatgatgaagctcaaaagggagaaatacaggatgaatatggtgaggatgatgtcttc
ctcaagaagattgagagtaacatgttgacagagatggcccttcgtggaattccaggtatt
aacaaagtgtttatcaaagaggggaacgtcaataaatttgaggacaatgatggcttcaaa
acagagaaggggtggatgcttgatacagaaggtgttaatctcttggctgtcatgtgccat
gaagatgttgatgctactaggacaacaagtaaccatttgattgaagtaattgaggttctt
ggaatcgaggctgtccgccgagctctcttggatgagctgagggttgtcatatcttttgat
ggatcttatgtcaactacaggcatctggccgttctttgtgatacaatgacatacagggga
catctgatggctattacaaggcatggtatcaaccgtaatgacacagggcctcttatgaga
tgttcttttgaagagactgtggacatcttgcttgatgctgctgtatatgctgaatctgac
cccctgagaggtgtcagcgagaacattatgcttggccagcttgctcctataggtacagga
ggctgtgatctgtatctgaacgatcagatgctgaagcaggccatcgagcttcaactccca
agctatgttgaaggcctggactttggcatgatgacatcagcatgctcgcccatctctggg
acaccatatcatcaagggatgatgtcgccaagttacctgctgagtccagacatcagggct
tcccccactgcagcagatgctcagttctcgccgtatgttggaggaatggctttctcaccc
gtatcttcaccaggcaactacactccttcgtcagggggtggttacagtccatctcctccc
gtatgtactccagggccaggaagcttcacctcttcatcaccatataatcctgtctctcct
ttttactcgcctgccagtccattatcatgcccacttaccagtccgtcatatgtgcctacc
agtctaccacactcaccaacatctccaatatacagcgctacatctcctatctacagccct
tcatctcctatctacagccctacatcactaagttacagtcccacatcaccagtttatagt
ccgacttctcctgtatataacccaacttcttctgcatacagccccacatcaccatcttat
aaccctacatcgccgtcttacagttacagccccacatcaccatcttatagccccacatcg
ccgtcttacagttacagccccacatcaccatcttatagccccacatcgccgtcttacaat
tacagccccacatcaccgtcatatagcccaacatcgccgtcttacagccccacatcacca
tcatacagcccaacatcgccgtcttacagtccgacgtcaccctcatatagtccgacatcg
tctgcatacagccctacttcgcctgcatacagcccaacatctcctggctacagcccaaca
tctccaagctacagcccatcttcgccaagctacaatccttcttcggtcaagtacacgcct
tcacatgcatactctccaagcagcccaaattactacagctcaacatcgccgacatactca
cctacctcaccatcatactcgcaaccaagcccgtcatacagcccaacaagtcgagtggaa
gaagaagcgcatgaggaggctgaagaggaagagccaaaaagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267835
Entry
9267835           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase II subunit 1
  KO
K03006  DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    9267835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9267835
   03400 DNA repair and recombination proteins [BR:osa03400]
    9267835
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     9267835
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     9267835
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      9267835
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_6 RNA_pol_Rpb1_7 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_R
Other DBs
NCBI-GeneID: 9267835
NCBI-ProteinID: XP_015649819
LinkDB
Position
8:complement(3224272..3234028)
AA seq 1855 aa
MDARFPYSPAEVAKVQLVQFGILSPDEIRQMSVVQIEHAETMERGKPKPGGLSDPRLGTI
DQKIKCETCMAGMAECPGHFGHLELAKPMFHIGFIKTVLSIMRCVCFNCSKILADEDDTK
FKQALKIRNPKNRLKRIYDACKSKKVCAGGDDLDVQEQQDTDEPVKKRGGCGAQQPNITV
DGMKMVAEFKAPKKKNDDQEQLPEPVERKQILSAERVLNVLKRISDEDCLLLGLNPKFAR
PDWMILQVLPIPPPPVRPSVMMDTSSRSEDDLTHQLAMIIRHNENLRRQERNGAPAHIIT
EFAQLLQFHIATYFDNELPGQPRATQRSGRPIKSICSRLKAKEGRIRGNLMGKRVDFSAR
TVITPDPNINIDELGVPWSIALNLTYPETVTPYNIERLKELVEYGPHPPPGKTGAKYIIR
EDGQRLDLRYVKKSSDQHLELGYKVERHLNDGDFVLFNRQPSLHKMSIMGHRIKIMPYST
FRLNLSVTSPYNADFDGDEMNMHVPQSFETRAEVLELMMVPKCIVSPQSNRPVMGIVQDT
LLGCRKITKRDTLIEKDVFMNILMWWEDFDGKVPAPAILKPRPIWTGKQVFNLIIPKPIN
LIRFSAWHSEAETGFITPGDTMVRIEKGELLSGTLCKKTLGTSTGSLIHVIWEEVGPDAA
RKFLGHTQWLVNYWLLQNGFSIGIGDTIADAATMVKINETISKAKDDVKELIMQAHDKQL
EAEPGRTMMESFENRVNQVLNKARDDAGSSAQKSLSESNNLKAMVTAGSKGSFINISQMT
ACVGQQNVEGKRIPFGFIDRTLPHFTKDDYGPESRGFVENSYLRGLTPQEFFFHAMGGRE
GLIDTAVKTSETGYIQRRLVKAMEDIIVKYDGTVRNSLGDVIQFLYGEDGMDAVWIESQK
LDSLKMKKGEFDNVFRYELDDENWRPNYMLPEHVDDLKTIREFRNVFEAEVQKLEADRFQ
LGSEIATTGDNTWPMPVNLKRLIWNAQKTFKIDLRRPSDMHPMEIVEAIDKLQERLKVVP
GDDAMSIEAQKNATLFFNILLRSTFASKRVLKEYRLTKEAFEWVIGEIESRFLQSLVAPG
EMIGCVAAQSIGEPATQMTLNTFHYAGVSAKNVTLGVPRLREIINVAKKIKTPSLSVYLK
PEVNKKKELAKNVQCALEYTTLRSVTHATEIWYDPDPLGTIIEEDVEFVRSYYEMPDEDI
DPDKISPWLLRIELNREMMVDKKLSMADIAEKINHEFDDDLSCIFNDDNADKLILRVRIT
NDEAPKGEIQDESAEDDVFLKKIESNMLTEMALRGIPDINKVFIKYGKVNKFEDNVGFKA
DNEWMLDTEGVNLLAVMCHEDVDATRTTSNHLIEVIEVLGIEAVRRALLDELRVVISFDG
SYVNYRHLAILCDTMTYRGHLMAITRHGINRNDTGPLMRCSFEETVDILLDAAVYAESDY
LRGVTENIMLGQLAPIGTGGCALYLNDQMLQQAIELQLPSYVEGLDFGMTPARSPISGTP
YHEGMMSPSYLLSPNIRASPITDAQFSPYVGGMAFSPVPSPGYTPSSGGGYSPSSPVYSP
GPGYSPTSPSYSPASPSYSPTSPSYTPGSPTYSPTSPSYSPTSPSYSPTSPSYSPTSPSY
SPTSPSYSPTSPSYSPTSPSYSPTSPVYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPNYS
PTSPSYNPSSAKYSPSHAYSPSSPRLSPYSQTSPNYSPTSPTYSPTSPSYSQPSPSYSPT
SPYTTSGGPSPDYSPTSPNYSPSGSYSPTAPGYSPSSTGQQFSPQAADKDKEKAK
NT seq 5568 nt   +upstreamnt  +downstreamnt
atggatgcgaggttcccgtactcgccggccgaggtggccaaggtgcagctggtgcagttc
ggcatcctcagccccgacgagatcaggcaaatgtcagtggtgcagatagagcatgcagaa
accatggaaagggggaagcccaagcctggtggcttgagtgaccctcggttggggactatt
gaccagaagatcaaatgtgagacatgcatggctgggatggcggagtgcccaggccacttt
ggccaccttgagcttgctaagccaatgttccatatcggcttcatcaagactgtactctcc
ataatgcgttgcgtctgcttcaattgttccaagatccttgcggatgaggatgataccaag
ttcaagcaggctcttaaaataaggaacccaaaaaatagactgaaaagaatatatgatgct
tgcaagagcaaaaaagtttgcgcggggggtgatgacctcgatgttcaggagcagcaagat
actgatgagccagtaaagaaaaggggtggctgtggtgctcagcagccaaatatcactgtt
gatggtatgaagatggttgcagagtttaaagcaccaaagaagaaaaacgatgatcaagag
caactccctgaaccagtggagcgaaagcaaatcctctcagctgagagggtgctcaatgtt
cttaaacgtataagtgatgaggactgtcttctattgggtctgaaccctaaatttgcccgc
cctgactggatgattttgcaagtccttccaattcccccaccccctgtgaggccatctgtc
atgatggatacctcttccagaagtgaggatgatttgactcatcaattagctatgataatt
cgacataatgagaacttgaggaggcaagagagaaatggggccccagctcacataataaca
gagtttgctcaattgttgcaatttcacattgcaacatactttgacaatgaacttcctggc
cagccaagggccacacagcgttctggaaggcctattaaatcaatttgcagcaggctgaaa
gcaaaggaaggccgcattagaggaaacttgatgggaaagcgtgttgatttctcagctcgt
actgtcatcacaccagatccgaatattaacattgatgaattgggagtgccatggagtatt
gctttgaacttgacatacccagaaactgtcactccatataacatcgagagattgaaagag
cttgttgaatatgggcctcaccctccccctggcaagacaggtgcaaagtatattatcagg
gaagacggtcagaggcttgatcttcgttatgtgaagaaaagtagtgatcagcatctggag
ctgggatacaaggtggaaaggcacctcaatgatggggattttgttctcttcaaccggcag
cccagtcttcacaaaatgtctatcatggggcatcgcattaaaatcatgccgtattcaact
tttcgcctaaacctgtccgttacttcaccatacaatgcagattttgatggggatgaaatg
aatatgcatgttccgcagtcatttgagaccagagctgaagttctagagttgatgatggtt
ccaaaatgtattgtgtctcctcagtcgaataggcctgttatgggtattgtccaggacacg
cttcttggctgtcgcaaaattactaaaagagatactcttattgaaaaggatgtgtttatg
aacatcttaatgtggtgggaagatttcgatggaaaggtccctgcccctgccattttgaaa
ccaaggcctatttggactgggaaacaagttttcaacttgattattcccaagccaatcaat
ttaattagattttcagcctggcattctgaagctgaaacaggatttattactcctggtgat
actatggtccggatagagaagggagagcttctatctggtacactttgcaaaaagacactt
gggacatcaactggaagtcttattcatgttatttgggaagaggttggtccagatgctgct
cgcaagttcttaggtcatacacagtggctagtcaactactggcttctgcaaaatggtttc
agtattggaattggggatacaattgcagatgctgccaccatggtgaagattaatgagaca
atctcaaaagctaaagatgatgtgaaggagcttattatgcaagctcatgataaacaattg
gaagctgagccaggacgcaccatgatggaatcattcgaaaatagagtaaatcaggttctt
aacaaggctcgtgatgatgctggaagtagtgcccagaagagtttgtctgaaagcaacaac
ctgaaggctatggttactgcaggctcaaaaggaagtttcatcaatatttctcaaatgact
gcttgtgtcggacagcagaatgttgagggcaagcggatcccatttggcttcattgatcga
acgttgccccacttcacaaaagatgattatggtcctgaaagtcgtgggtttgtggagaac
tcttaccttagaggtctgacaccacaagaatttttctttcatgctatgggtggtagagaa
ggtctgattgatactgctgtgaagacctctgagactggatatatccagcgacgacttgtg
aaggctatggaagatatcatagtgaaatatgatggtacggtaagaaattccttgggagac
gtcattcagttcttatatggagaagatggcatggatgctgtttggattgagtcacagaag
ttggattccttgaagatgaagaagggtgagtttgataatgtatttcgttatgaactggac
gatgagaactggaggccaaattacatgttaccagaacatgttgatgatttgaagaccatt
cgtgagtttagaaatgtgtttgaagcagaggttcagaagctagaagctgaccggttccag
cttggttctgagattgccacaactggtgataatacatggcctatgcctgtcaacctcaaa
cggcttatctggaatgcacagaagacattcaagattgatctcagaaggccttctgacatg
cacccaatggaaattgtggaggcaatagataagctgcaagaaagactgaaggttgttcct
ggtgatgatgctatgagtattgaggctcagaagaatgcaactttgttcttcaatatcctg
cttcgaagcacattcgctagcaagagggtcttgaaggagtacaggcttacaaaggaagct
tttgaatgggttattggtgagattgaatcgagattccttcagtctttggtggctcctggt
gaaatgattggatgcgtagctgcacagtccattggagaaccggcaactcagatgaccctg
aatacttttcattatgctggtgtcagtgccaagaatgtcactcttggagttcccaggctg
agagagatcattaatgttgctaagaagataaaaactccatcattgtcagtttacctaaag
cctgaggtgaacaagaagaaagaactggctaagaatgtccaatgtgccttagagtacact
actctgcgcagtgtgacacatgctacagagatatggtatgatcctgatccactgggaacc
attattgaagaagatgttgaatttgtccggtcctattatgaaatgcctgatgaggatatt
gacccggataaaatttcaccgtggctgctgcgtatcgagctgaatcgtgagatgatggtt
gataagaagttgagcatggctgatattgcagagaagatcaatcatgaatttgatgatgac
ttgtcatgcatatttaatgatgataatgcggataaactgatccttcgtgtccgcatcaca
aatgatgaagctccaaagggagaaatacaggatgagtctgctgaggatgatgtcttcctc
aagaagattgaaagtaacatgttgacagagatggcacttcgtggaattccagatattaac
aaagtttttatcaaatatgggaaggtcaataaatttgaggacaatgttggcttcaaagca
gataatgagtggatgcttgatacagaaggtgttaatctcttggctgtcatgtgccatgaa
gatgttgatgctactaggacaacaagtaaccatttgatcgaagtaattgaggttcttgga
atcgaggctgttcgtcgagctctcttggatgagctgcgggtggtcatatctttcgatggt
tcttatgtcaattacagacatctggccattctttgtgatacaatgacatacagagggcat
ctgatggctattacaaggcatggtatcaaccgtaatgacacagggcctcttatgagatgt
tcctttgaagagacggtggatatcttgcttgatgctgctgtatatgctgaatctgactac
ctgagaggtgtcactgagaacattatgcttggccagcttgcacctatcggtacaggaggc
tgtgcattgtatctcaatgatcagatgctgcagcaggccatcgaacttcaactcccaagc
tatgttgaaggcctggactttggcatgacaccagcacgctcgcccatctctgggacacca
tatcatgaaggaatgatgtcaccgagctacctgctaagtccaaacatcagggcttccccc
attacagatgctcagttctcgccatatgttggaggaatggctttctcaccagtaccttca
ccaggctacactccatcgtcagggggtggttacagtccatcttctccggtatacagtcca
gggccaggatacagcccaacttctccatcatatagtcctgcttcacccagctacagtccc
acttctccatcatatacacctggctctcctacttactctccaacaagtccatcatactcg
cctaccagtccatcatactcgccaacatctccaagctacagccctacatcacctagctat
agccctacatctccaagttacagcccgacctcgccaagttatagtcccacttctccgagc
tacagtccgacatcaccagtttatagtccgacttctcctgcatatagtccaacttctcct
gcatacagccccacatcaccatcttatagccccacatcaccatcttacagccccacatca
ccatcatatagcccaacatctccatcatacagtccaacatctccgtcttacagccccact
tccccctcatacagtccgacatcaccctcgtacagtccgacatctcctgcatacagccct
acatcacctggttacagcccgacatctccaagctacagcccaacttcaccaaattacagt
ccaacttcaccaagctacaatccttcttcggccaagtacagtccttcccacgcgtactct
ccaagcagcccaaggctgagcccttatagtcagacttcaccaaattacagcccaacatcg
ccgacatactcacctacctcaccatcatattcacaaccaagtccgtcatacagcccaaca
agcccatacaccacatctggagggcccagcccagattatagcccaacatctccgaattac
agccctagcggaagctactcccccactgcaccgggctactcaccatcctccaccggccag
cagttctctccccaagctgccgacaaggacaaggagaaggcaaaatga

DBGET integrated database retrieval system