KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337900
Entry
4337900           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-processing-splicing factor 8
  KO
K12856  pre-mRNA-processing factor 8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4337900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4337900
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    4337900
 Complex C
   U5 SnRNP specific factors
    4337900
SSDB
Motif
Pfam: PROCN PRP8_domainIV U6-snRNA_bdg PRO8NT U5_2-snRNA_bdg PROCT RRM_4 JAB
Other DBs
NCBI-GeneID: 4337900
NCBI-ProteinID: XP_015639300
LinkDB
Position
5:complement(3704249..3714718)
AA seq 2363 aa
MWSGGPPPPPPPPMGAAPPPPGTGAPPPPLPAAAAAAGPPGGGKPLTPAELEAQLVEKAR
KWHQLNSKRYGDKRKFGFVEAQKEDMPPEHVRKIIRDHGDMSSKKYRHDKRVYLGALKFV
PHAVYKLLENMPMPWEQVRHVKILYHITGAITFVNEIPWVVEPIYLAQWGTMWIMMRREK
RDRRHFKRMRFPPFDDEEPPLDYADNLLDVEPLEAIQLELDEEEDSAVHEWFYDHKPLVK
TKLINGPSYRKWHLSLPIMATLYRLAGQLLSDLIDRNYFYLFDMESFFTAKALNMCIPGG
PKFEPLYRDMEKGDEDWNEFNDINKLIIRQPLRTEYRIAFPHLYNNRPRKVRLGVYHTPM
IMYIKTDDPDLPAFYYDPLINPITSTSKVDRRERRTIEEDEDEDFCLPDGVEPLLKGTEL
YTDTTAAGISLLFAPKPFNMRSGRTRRAEDIPLVSEWYKEHCPPAYPVKVRVSYQKLLKC
YVLNELHHRPPKAQKKKHLFRSLQATKFFQTTELDWAEAGLQVCKQGYNMLNLLIHRKNL
NYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDANIQFRLGNVDAFQ
LADGLQYIFSHVGQLTGMYRYKYRLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPM
WRVWLFFLRGIVPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDV
LDAMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPVPIENMILRYVKSKADWWTNV
AHYNRERIRRGATVDKTVCRKNLGRLTRLWLKAEQERQHNYLKDGPYVTPEEAVAIYTTT
VHWLESRKFSPIPFPPLSYKHDTKLLILALERLKESYSVAVRLNQLQREELGLIEQAYDN
PHEALSRIKRHLLTQRAFKEVGIEFMDLYSYLIPVYEIEPLEKITDAYLDQYLWYEGDKR
HLFPNWVKPADSEPPPLLVYKWCQGINNLQDVWDTSDGQCVVMLQTKFEKFFEKIDLTLL
NRLLRLVLDHNIADYVTAKNNVVLSYKDMSHTNSYGLIRGLQFASFVVQYYGLVLDLLLL
GLTRASEIAGPPTMPNEFLTYADTKVETRHPIRLYSRYVDKVHIMFRFTHEEARDLIQRY
LTEHPDPNNENMVGYNNKKCWPRDARMRLMKHDVNLGRSVFWDMKNRLPRSITTLEWENS
FVSVYSKDNPNLLFSMCGFEVRILPKIRMTQEAFSNTKDGVWNLQNEQTKERTAIAFLRV
DDEHMKVFENRVRQILMSSGSTTFTKIVNKWNTALIGLMTYFREATVHTQELLDLLVKCE
NKIQTRIKIGLNSKMPSRFPPVIFYTPKEIGGLGMLSMGHILIPQSDLRYSKQTDVGVTH
FRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAQSQNRRLTLEDLEDSW
DRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRT
DVIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNR
RFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMD
LCQVLDQELDALEIETVQKETIHPRKSYKMNSSCADILLFAAHRWQMSKPSLVSESKDVF
DQKASNKYWIDVQLRWGDYDSHDIERYTRAKFMDYTTDNMSIYPSPTGVMIGIDLAYNLH
SAFGNWFPGSKPLLQQAMNKIMKSNPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGEIF
SNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKVIHTSVWAGQKR
LGQLAKWKTAEEVAALVRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLP
FQACLKIEKFGDLILKATEPQMVLYNIYDDWLKSISSFTAFSRIVLILRALHVNNEKAKM
LLKPDKTIVTEPHHIWPTLTDEQWLKVECALRDLILSDYAKKNNVNTSALTQSEIRDIIL
GAEIAPPSQQRQQIAEIEKQSRETTQLTAVTTRTTNVHGDELIITTTSPYEQQAFASKTD
WRVRAISATNLYLRVNHIYVNSDDIKETGYTYIMPKNILKKFICIADLRTQIAGFLYGLS
PQDNPQVKEIRCIAIPPQHGTHQMVTLPANLPEHEFLNDLEPLGWMHTQPNEAPQLSPQD
LTSHAKILENNKQWDGEKCIILTCSFTPGSCSLTAYKLTPSGYEWGRSNKDSGSNPHGYL
PTHYEKVQMLLSDRFLGFYMVPDNTPWNFNFMGVKHDPLMKYNMKLGTPRDFYHEDHRPT
HFLEFSNIDEGEVAEGDREDTFT
NT seq 7092 nt   +upstreamnt  +downstreamnt
atgtggagcggcgggccgccgccgcctccccctccgccgatgggggccgcgccgcctccc
ccgggcacgggcgctccgcctccgccgctgccggcggcggcggcggccgcgggtcccccc
ggcggcggcaagccgctgacgccggcggagctcgaggcgcagctggtggagaaggcgagg
aagtggcaccagctcaactcgaagcggtacggcgacaagcgcaagttcgggttcgtcgag
gcgcagaaggaggacatgccccccgagcacgtccgcaaaatcatcagggaccatggtgac
atgtcttcaaagaagtacaggcacgataagcgtgtatatcttggagcactcaaatttgtg
cctcatgctgtttacaagctactggaaaatatgccaatgccctgggaacaggtccggcat
gtaaagattctgtaccatatcactggtgcaataacctttgtaaatgagatcccatgggta
gttgagcccatttaccttgcacagtggggcacgatgtggatcatgatgaggagggagaag
agagataggcgacatttcaagagaatgcgctttcctccatttgatgatgaggaacctcca
ttagactatgctgataatttgctggatgttgaaccactggaggctatacagttggaattg
gatgaggaggaagattcagctgtgcatgaatggttttatgatcataagccgcttgttaag
acaaagcttataaatggccccagctacaggaaatggcatctatcgcttcccataatggca
acactctatcgtcttgctggccaacttttgtcagatttgattgatcgaaattatttctat
ttgtttgatatggagtctttctttaccgccaaagcactcaacatgtgtatcccaggaggt
ccgaagtttgagccactgtaccgtgatatggagaagggggatgaggactggaatgagttt
aatgacatcaacaaactcatcatccgccaaccacttaggacagagtatagaattgctttt
ccacacttgtacaataacaggccaaggaaagtgaggcttggggtatatcatactccaatg
ataatgtatatcaagacagatgatccagacttgcctgcattttactatgatcctttgata
aatcctataacttcgacaagcaaggttgatcgtcgggagaggaggacaattgaagaggat
gaagatgaggacttctgtctcccggatggtgtggagcccctcttgaaaggaacagaactt
tacactgatacaacagcagctggcatttcattactctttgctccaaagccttttaatatg
aggtctggtagaacacgtcgtgctgaagatatccctcttgtatctgaatggtacaaggag
cactgcccaccagcttatccagtgaaggtgcgtgtcagctatcagaagctactgaagtgt
tatgtgctcaatgagctacatcataggcctcccaaggcgcagaagaagaagcatctgttc
cgttcactccaagcgacaaagttttttcaaacaacggagcttgactgggcagaagcaggt
ttgcaagtttgcaaacagggttacaatatgttgaacttgttgatccacagaaagaacctt
aactaccttcacttagactacaacttcaatttgaaacctgtgaagactctcacaacaaag
gaaaggaaaaaatctcggtttggaaatgcatttcatttatgccgtgagatattacgactt
actaagttagtagttgatgcaaacatccagttccgcttgggaaatgttgatgctttccag
ttagcagatggcttgcaatatatattctctcatgttggccagctgactggtatgtaccgc
tacaagtatcgtctgatgcggcaaatcaggatgtgcaaagatctgaagcacttgatatac
taccggttcaatactggtcctgtaggaaaaggacctggctgtggattctgggctccaatg
tggagggtgtggctgttttttctgcggggtattgtaccactgcttgaaagatggttaggt
aatctactggccaggcagtttgagggtcgtcattcaaaaggagttgctaaaactgtaacc
aagcaacgtgttgagtctcactttgatcttgaacttcgagctgctgttatgcatgatgtc
cttgatgctatgcctgagggtatcaagcaaaacaaggcacggactatactacagcatctt
agtgaggcatggcggtgctggaaggcaaatatcccatggaaggtcccaggcctaccggtt
cctattgagaacatgatacttcgttatgtaaagtccaaggctgattggtggaccaatgtt
gctcactacaatcgtgagcgtatcaggcgtggtgctacagtcgacaagactgtgtgccgc
aagaatcttggaagattaacccgtttgtggctgaaggcagaacaggagaggcagcacaac
tacctgaaagatgggccatatgtgacacctgaagaggcagttgctatctacacaacaaca
gttcattggctagaatcaaggaagttctcacctattccttttcctcctctttcttacaag
catgacaccaaacttcttatactagctctggaaaggctaaaggaatcttacagcgtggca
gtaaggttaaatcaactgcagcgggaggaacttggattgattgagcaagcatatgataat
cctcatgaggcactgtcaaggataaagcggcatcttcttactcagcgtgcttttaaagaa
gttggcattgagtttatggacctgtacagctaccttattccggtatatgaaattgagcct
cttgagaaaatcaccgatgcttaccttgaccagtacttgtggtatgagggggacaagcga
cacctattcccgaactgggtcaagcctgctgattcagaaccacctcctctgcttgtttac
aaatggtgccaaggtataaataatctacaggatgtatgggacactagtgacgggcagtgt
gttgtgatgctgcagacaaaatttgaaaagttcttcgaaaaaattgatctgacactgttg
aacaggcttctgcggttggtcttggaccacaatattgctgattatgtcactgcaaagaac
aatgttgtattatcttacaaggatatgagtcatactaattcttatggtctcattcggggt
ctacagtttgcatcatttgttgtgcaatactatgggcttgtgctggatctccttctgctc
ggtttaacacgtgcaagcgagattgcggggccacctacgatgcctaatgagttccttaca
tatgctgataccaaagttgagacaaggcatcctattcggctgtattctcggtatgtcgac
aaggtgcatataatgttccgctttactcacgaggaagcacgcgatttaattcagcgttat
ttgactgagcatcctgatcctaataatgagaacatggtcggttacaacaacaagaaatgt
tggcctagagacgcaagaatgaggctcatgaagcatgacgtaaatcttggaagaagtgtt
ttttgggacatgaagaaccgcctcccaaggagcatcacaacgttagagtgggagaacagc
tttgtctctgtttacagcaaggacaaccctaatctgctttttagcatgtgcgggtttgag
gttcgtatactaccaaagatacggatgactcaagaagcgtttagtaacaccaaagatgga
gtctggaatttgcagaatgaacagacaaaagaaaggacagctattgcctttctaagagtt
gatgatgaacatatgaaagtgtttgagaaccgtgtcaggcaaatccttatgtcctcaggg
tcgactacattcactaagattgttaacaagtggaataccgctctcattggtcttatgaca
tatttccgggaagcaactgtccatacccaggagctcttggatttacttgtcaaatgtgaa
aacaagatccagactcgcataaagattggcctgaactcaaaaatgcctagcaggtttccg
cctgttatcttctatacacccaaggaaattggaggtctgggaatgttatcgatgggtcac
attctgataccacagagtgacctcaggtacagtaaacagacagatgttggtgtgacacat
tttcggagtggtatgagccatgaagaggaccagcttatccctaacttatatcgctacatt
cagccctgggagagtgagtttattgattcacagcgggtttgggctgagtatgctttgaag
aggcaggaagcacaatcacagaacagacggttgacacttgaggatcttgaagattcatgg
gatagaggtattcctcgtatcaacactcttttccaaaaagaccgtcatactttggcatat
gataagggatggagagtgagaacagatttcaagcagtaccaagtgctcaaacaaaaccca
ttctggtggacacatcagagacatgatggaaagctatggaacctaaacaactataggact
gatgtcatccaagctcttggtggtgttgagggtattttggaacacaccttgtttaaagga
acatatttccctacttgggagggtctgttttgggagaaagcgtcaggttttgaggagtcc
atgaaatacaagaagctgactaatgcacaacgttctggtctcaatcagatacccaaccga
agatttaccctgtggtggtcaccaaccatcaatcgtgcaaatgtgtatgttggtttccag
gttcagctagatcttaccgggattttcatgcatgggaaaattccaaccctgaagatttct
ttaatccagatcttccgtgcgcatctgtggcagaagatccatgaaagtgttgttatggat
ctttgccaagttttggatcaagagctggatgcactggagattgagacagtgcagaaagag
acaatacatccgagaaagagctacaagatgaacagctcctgtgcagatatcctccttttt
gcggcacataggtggcagatgtccaaaccaagcttagtctctgagtcaaaggatgtcttt
gatcagaaagctagtaacaagtattggattgatgtgcaactacgctggggagactatgat
tcacatgacattgagcgttatacaagggccaagttcatggactacactactgacaatatg
tctatctatccatctccaactggggtgatgattggaattgatctagcatataatttgcac
tctgcttttggcaattggttccctgggtcaaagcccctccttcagcaagcaatgaacaag
ataatgaagtcaaatcctgctctgtacgtgctgagggagagaataaggaagggtctacaa
ctgtattcttcggaacccactgagccatatttgtcttcacagaactatggagagatattc
agcaatcagatcatatggtttgtggatgacacaaatgtctatcgagttaccattcacaaa
acattcgagggtaacttgaccactaaaccaatcaatggtgctatttttatttttaatcca
agaactggtcaattatttctgaaggtcatccacacaagtgtatgggctggacaaaagcgt
cttggacagctggccaagtggaaaacagctgaagaggttgctgcattagttcggtcgctt
cctgtagaagagcagccaaagcaaatcattgtgacaaggaagggcatgttggatcctttg
gaggtccatctgcttgacttccctaacatcgttatcaagggcagtgagttgcagctgcca
ttccaagcttgtttgaagattgagaagtttggtgatcttattctcaaggctacagaaccc
cagatggttctgtacaacatatatgatgattggttgaagagtatctcatcattcactgct
ttctctcggattgtgcttatattgcgtgcacttcatgtcaataatgagaaggcaaagatg
ctgctcaagcctgacaagaccattgttacggaaccacatcatatttggccaaccttgact
gatgagcaatggctgaaggttgaatgtgcactcagggaccttattctgtctgattatgcg
aagaaaaacaatgttaatacttctgcattgacacaatctgaaattcgtgatatcatactt
ggtgctgaaatagctccaccatcacagcagaggcaacagatagctgaaattgagaaacag
tctagagagacgactcagctgactgcagttactacaaggacaaccaatgtgcatggagat
gagctcatcatcacgacgaccagtccgtatgagcaacaagcatttgcatcaaagactgat
tggcgtgtcagggccatctctgccacgaacttgtatcttcgtgttaatcacatttatgtt
aattcagatgatataaaggagactggctacacttacattatgccgaagaatatattaaag
aagttcatatgcatagcagatttaaggacacagattgcaggttttctatatgggctgagt
ccacaggataacccccaagttaaagagatcagatgcatagctattcctccacagcacgga
actcatcagatggtgacactgcctgcaaaccttcctgagcacgagttccttaatgatttg
gagccactgggctggatgcatacccagcctaatgaagctccccagctatcaccacaggat
ttgacatcgcacgccaagatcttggagaacaacaagcaatgggatggtgagaagtgcatc
attttgacatgcagctttaccccaggatcttgttcattgaccgcgtacaagttgacgcca
agtggttacgagtggggccgtagcaacaaggacagtggaagcaacccacatggatatctc
ccgactcactacgagaaggtccagatgcttctcagtgacagattcctaggattctacatg
gtgccggataacaccccttggaacttcaacttcatgggagtgaagcacgacccgctgatg
aagtacaacatgaagcttggcacgcccagggacttctatcacgaggaccatcggccgaca
catttcctcgagttcagcaacatcgacgagggcgaggtcgcggaaggtgatagggaggac
accttcacgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340248
Entry
4340248           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-processing-splicing factor 8
  KO
K12856  pre-mRNA-processing factor 8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4340248
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4340248
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    4340248
 Complex C
   U5 SnRNP specific factors
    4340248
SSDB
Motif
Pfam: PROCN PRP8_domainIV U6-snRNA_bdg PRO8NT U5_2-snRNA_bdg PROCT RRM_4 JAB
Other DBs
NCBI-GeneID: 4340248
NCBI-ProteinID: XP_015642864
LinkDB
Position
6:complement(3363867..3373877)
AA seq 2278 aa
MPPEHVRKIIRDHGDMSSKKYRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRHVKILY
HITGAITFVNEIPWVVEPIYLAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYAD
NLLDVEPLEAIQLELDEEEDSAVHEWFYDHKPLVKTKLINGPSYRKWHLSLPIMATLYRL
AGQLLSDLIDRNYFYLFDMESFFTAKALNMCIPGGPKFEPLYRDMEKGDEDWNEFNDINK
LIIRQPLRTEYRIAFPHLYNNRPRKVRLGVYHTPMIMYIKTEDPDLPAFYYDPLINPITS
TNKVDRRERRTTEEDEDEDFRLPDGVEPLLKGTELYTDTTAAGISLLFAPKPFNMRSGRT
RRAEDIPLVSEWYKEHCPPAYPVKVRVSYQKLLKCYVLNELHHRPPKAQKKKHLFRSLQA
TKFFQTTELDWAEAGLQVCKQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKS
RFGNAFHLCREILRLTKLVVDANIQFRLGNVDAFQLADGLQYIFSHVGQLTGMYRYKYRL
MRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPMWRVWLFFLRGIVPLLERWLGNLLAR
QFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDVLDAMPEGIKQNKARTILQHLSEAWR
CWKANIPWKVPGLPVPIENMILRYVKSKADWWTNVAHYNRERIRRGATVDKTVCRKNLGR
LTRLWLKAEQERQHNYLKDGPYVTPEEAVAIYTTTVHWLESRKFSPIPFPPLSYKHDTKL
LILALERLKESYSVAVRLNQLQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEF
MDLYSYLIPVYEIEPLEKITDAYLDQYLWYEGDKRHLFPNWVKPADSEPPPLLVYKWCQG
INNLQDVWDTSDGQCVVMLQTKFEKFFEKIDLTLLNRLLRLVLDHNIADYVTAKNNVVLS
YKDMSHTNSYGLIRGLQFASFVVQYYGLVLDLLLLGLTRASEIAGPPTMPNEFLTYADTK
VETRHPIRLYSRYIDKVHIMFRFTHEEARDLIQRYLTEHPDPNNENMVGYNNKKCWPRDA
RMRLMKHDVNLGRSVFWDMKNRLPRSITTLEWENSFVSVYSKDNPNLLFSMCGFEVRILP
KIRMTQEAFSNTKDGVWNLQNEQTKERTAIAFLRVDDEHMKVFENRVRQILMSSGSTTFT
KIVNKWNTALIGLMTYFREATVHTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVIFY
TPKEIGGLGMLSMGHILIPQSDLRYSKQTDVGVTHFRSGMSHEEDQLIPNLYRYIQPWES
EFIDSQRVWAEYALKRQEAQSQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWR
VRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDVIQALGGVEGILEHTLFKGTYFPT
WEGLFWEKASGFEESMKYKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDL
TGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVLDQELDALEIETVQKETIHPR
KSYKMNSSCADILLFAAHRWQMSKPSLVSESKDVFDQKASNKYWIDVQLRWGDYDSHDIE
RYTRAKFMDYTTDNMSIYPSPTGVMIGIDLAYNLHSAFGNWFPGSKPLLQQAMNKIMKSN
PALYVLRERIRKGLQLYSSEPTEPYLSSQNYGEIFSNQIIWFVDDTNVYRVTIHKTFEGN
LTTKPINGAIFIFNPRTGQLFLKVIHTSVWAGQKRLGQLAKWKTAEEVAALVRSLPVEEQ
PKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKIEKFGDLILKATEPQMVLY
NIYDDWLKSISSFTAFSRIVLILRALHVNNEKAKMLLKPDKTIVTEPHHIWPTLTDEQWL
KVECALRDLILSDYAKKNNVNTSALTQSEIRDIILGAEIAPPSQQRQQIAEIEKQSRETT
QLTAVTTRTTNVHGDELIITTTSPYEQQAFASKTDWRVRAISATNLYLRVNHIYVNSDDI
KETGYTYIMPKNILKKFICIADLRTQIAGFLYGLSPQDNPQVKEIRCIAIPPQHGTHQMV
TLPANLPEHEFLNDLEPLGWMHTQPNEAPQLSPQDLTSHAKILENNKQWDGEKCIILTCS
FTPGSCSLTAYKLTPSGYEWGRSNKDTGSNPHGYLPTHYEKVQMLLSDRFLGFYMVPDNT
PWNFNFMGVKHDPLMKYNMKLGTPRDFYHEDHRPTHFLEFSNIDEGEVAEGDREDTFT
NT seq 6837 nt   +upstreamnt  +downstreamnt
atgccacccgagcacgtccgcaaaatcatcagggaccatggtgacatgtcttcaaagaag
tacaggcatgataagcgtgtatatcttggagcactcaaatttgtgcctcatgctgtttac
aagctattggaaaatatgccaatgccctgggaacaggttcggcatgtaaagatcctttac
catatcactggtgcaataacctttgtaaatgagatcccatgggtagttgagcccatttac
cttgcacagtggggcacgatgtggatcatgatgaggagggagaagagagataggcgacat
ttcaagagaatgcgctttcctccatttgatgatgaggaacctccattagactatgctgat
aatttgctggatgttgaaccactggaggctatacagttggagttggacgaggaggaagat
tcagctgtgcatgaatggttttatgatcataagccgcttgtgaagactaagcttataaat
ggccccagctaccggaaatggcatctatcgcttcccataatggcgacactctatcgtctt
gctggccaacttttgtcggatttgattgatcgaaattatttctatttgtttgatatggag
tctttctttaccgccaaagcactcaacatgtgtatcccaggaggtccgaagtttgagcca
ttgtaccgtgatatggagaagggggatgaggactggaatgagtttaatgacatcaacaaa
ctcatcatccgccaaccacttaggactgagtacagaattgcttttccacacttgtacaat
aacaggccaaggaaagtgaggcttggggtatatcatactccaatgataatgtatatcaaa
acagaggatccagacttgcctgcattttactatgatcctttgataaatcctataacttcg
actaacaaggttgatcgtcgggagaggagaacaactgaagaggatgaagatgaggacttc
cgtctcccggatggtgtggagcccctcttgaaaggaacagaactttacactgatacaaca
gcagctggcatttcattactctttgctccaaagccttttaatatgagatctggtagaaca
cgtcgtgctgaagatatccctcttgtatctgaatggtacaaggagcactgcccaccagct
tatccagtgaaggtgcgtgtcagctatcagaagctactgaagtgttatgtgctcaatgaa
ctacatcataggcctcccaaggcacagaagaagaagcacctgttccgttcactccaagct
acaaagttttttcaaacaacagagcttgactgggcagaagcaggtttgcaagtttgcaaa
cagggttacaatatgttgaacttgttgatccacagaaagaaccttaactaccttcacttg
gactacaacttcaatttgaaacctgtgaagacactcacaacgaaggaaaggaaaaaatct
cggtttggaaatgcatttcatttatgccgtgagatattacgacttactaagttagttgtt
gatgcaaacatccagttccgcttgggaaatgttgacgctttccagttagcagatggcttg
caatacatattctctcatgttggccagctgactggtatgtaccgctacaagtatcgtctg
atgcggcaaatcaggatgtgcaaagatctgaagcacttgatatactacaggttcaacact
ggtcctgtaggaaaaggacctggctgtggattttgggctccaatgtggagggtgtggctg
tttttcctgcggggtattgtgccactgcttgaaagatggttaggtaatttactggccagg
cagtttgaaggtcgtcattcaaaaggagttgctaaaactgtaaccaaacaacgtgttgag
tctcacttcgatcttgaacttcgagctgctgttatgcatgatgtccttgatgctatgcct
gagggtatcaagcaaaacaaggcacggactatactgcagcatcttagtgaggcatggcgg
tgctggaaggcaaatatcccatggaaggtcccgggcctacctgttcctattgagaacatg
atacttcgttatgtaaagtccaaggctgattggtggaccaatgttgctcactacaatcgt
gagcgtatcaggcgtggtgctacggttgacaagactgtgtgccgtaagaatcttggaaga
ttaactcgtttgtggctgaaggcagaacaggagaggcagcacaactatttgaaagatggg
ccatatgttacacctgaagaggcagttgctatttacacaacaacagttcattggcttgaa
tcaaggaagttctcgcctattccttttcctccactttcttacaagcatgacaccaaactt
cttatactagctctggaaaggctaaaggagtcttacagcgtggctgtaaggttaaatcaa
ctgcagcgggaggaacttggcttgattgagcaagcatatgataatcctcatgaggcgctt
tcaaggataaagaggcatcttcttactcagcgtgcttttaaagaagttggcattgagttt
atggacctgtacagctacctgatcccagtatatgaaattgagcctcttgagaaaatcact
gatgcctaccttgaccagtacttgtggtatgagggggacaagcgacacctattcccgaac
tgggtcaagcctgctgattcagaaccacctcctttgcttgtttacaaatggtgccaaggt
ataaataatctacaggatgtatgggacactagtgacgggcagtgtgttgtgatgctgcag
acaaaatttgagaagttcttcgaaaaaattgatctgacactgttgaacaggcttctgcgg
ttggtcttggaccataatattgctgattatgtcactgcaaagaacaatgttgtgttgtct
tacaaggatatgagtcatactaattcttatggtctcattcggggtctacagtttgcatca
tttgttgtgcaatactatggtcttgtgctggatctccttctgctcggtttaacacgtgca
agtgagatcgctgggccacctacaatgcctaatgagttcctcacatatgctgataccaaa
gttgagacaaggcatcctatccggttgtactctcggtatattgataaggtgcatataatg
ttccgctttactcatgaggaagcacgtgatttaattcagcgttatttgacagagcatcct
gatcctaataatgagaacatggtcggttacaacaacaagaaatgttggcctagagacgca
agaatgaggctcatgaagcatgatgtaaatcttggaagaagtgttttttgggacatgaag
aaccgccttccaaggagcatcacaacgttagagtgggagaacagctttgtctctgtttac
agcaaggacaaccctaatctgctgtttagcatgtgtgggtttgaggttcgtatactacca
aaaatacggatgactcaagaagcgtttagtaacaccaaagatggagtctggaacttgcag
aatgaacagacaaaagaaaggacagctattgcctttctaagagttgatgatgagcatatg
aaagtgtttgagaaccgtgtcaggcaaatccttatgtcctcagggtcaactacattcact
aagattgttaacaagtggaatactgctcttattggtcttatgacatatttccgtgaagca
actgttcatacccaggagctcttggatttacttgtcaaatgtgaaaacaagattcagact
cgcataaagattggactgaactcaaaaatgcctagcaggtttccgcctgttatcttctat
acacccaaggaaattggaggtctgggaatgttatcgatgggtcacattctgataccacag
agtgatctcaggtacagcaaacagacagatgttggtgtgacacattttcggagtggtatg
agccatgaagaggaccagcttatccctaacttatatcgctacattcagccctgggagagt
gagtttattgattcacagcgggtttgggctgagtatgctttgaagaggcaggaagcacaa
tcacagaacagacggttaacacttgaggatcttgaagattcatgggatagaggtattcct
cgtatcaacactcttttccaaaaagaccgtcatactttggcatatgataaaggatggaga
gtgagaacagactttaagcagtaccaagtgctcaaacaaaatccattctggtggacacat
cagagacatgatggaaaactatggaacctaaacaactataggactgatgtcatccaagct
cttggtggtgttgagggtattttggaacacaccttgtttaaaggaacgtatttccctact
tgggagggtctgttttgggagaaagcgtcaggttttgaggagtccatgaaatacaagaag
ctgacgaatgcacaacgttctggtctcaatcagatacccaaccgaagatttaccctgtgg
tggtcaccaaccatcaatcgtgcaaatgtgtatgttggtttccaggttcagctagatctt
acgggcattttcatgcatgggaaaattccgaccctgaagatttctttaatccagatcttc
cgtgcgcatctgtggcagaagatccatgaaagtgttgttatggatctttgccaagttttg
gatcaagagctggatgcactggagattgagacagtgcagaaagagacaatacatccgagg
aagagttacaagatgaacagctcctgtgcagatatcctcctttttgctgcacataggtgg
cagatgtctaaaccgagcttagtctctgagtcaaaggatgtctttgatcagaaagctagc
aacaagtattggattgatgtgcaacttcgatggggagactatgattcacatgacattgag
cgttatacaagggccaagttcatggactacactactgacaatatgtcgatatatccatct
ccaacaggggtgatgattggaattgatctagcatataatttgcactctgcttttggcaat
tggttccctgggtcaaagccccttcttcagcaagcaatgaacaagataatgaagtcaaat
cctgctctgtacgtgctgagggagagaataaggaagggtctacagctgtattcttcagaa
cccactgagccgtatttgtcttcacagaactatggagagatattcagcaatcagatcata
tggtttgtggatgacacaaatgtctatcgagttaccattcacaaaacatttgagggtaac
ttgaccactaaaccaatcaatggtgctatttttattttcaatccaagaactggtcaacta
tttctgaaggtcatccacacaagtgtatgggctggacaaaagcgtcttggacaactggcc
aagtggaaaacagctgaagaggttgctgcattagttcggtcgcttcctgtagaagagcag
ccaaagcaaatcattgtgacaaggaagggtatgttggatcctttggaggtccatctgctt
gacttccctaacattgtgatcaagggcagtgagctgcagctgccattccaagcttgtttg
aagattgagaagttcggtgatcttattctcaaggccacagaaccccagatggttctttac
aacatatatgatgattggttgaaaagtatctcatcattcactgctttctctcggattgtg
cttatattgcgtgcacttcatgtcaataatgagaaggcaaagatgctgctcaagcctgac
aaaactattgttacggaaccacatcatatttggccaaccttgactgatgagcaatggctg
aaggttgaatgtgcactcagggacctcatcctgtctgattatgcaaagaaaaacaatgtt
aatacgtctgcgctgacacaatctgaaattcgtgacattatacttggtgctgaaatagct
ccaccatcacagcagaggcaacagattgctgaaattgagaaacagtctagagagacgact
cagctgaccgcagttactacaaggacgaccaatgtgcatggagatgagctcatcatcaca
acgaccagtccatacgagcaacaagcatttgcatcaaagactgattggcgtgttagggct
atctctgccacaaacttgtatcttcgtgtcaatcacatttatgttaactcagatgatata
aaggagactggctacacttacattatgccaaagaatatattaaagaagttcatatgcata
gcagatttaaggacacagattgcagggtttctgtatgggctgagcccacaggataatccc
caagttaaagagatcagatgcatagctattcctccgcagcacggaactcatcagatggtg
acactgcctgcaaaccttcccgagcacgagttccttaatgatttggagccactgggatgg
atgcatacccaaccaaatgaagctcctcagctatcaccacaggatttgacatcacatgcc
aagatcttggagaacaacaagcaatgggacggtgagaagtgcatcattttgacatgcagc
tttaccccaggatcttgttcattgaccgcgtacaagctgacgccaagcggttacgagtgg
ggccgtagcaacaaggacaccggaagcaacccacatggatatctcccgactcactacgag
aaggtccagatgcttctcagcgacagattcctgggattctacatggtgccggataacacc
ccttggaacttcaacttcatgggagtcaagcacgacccgctgatgaagtacaacatgaag
cttggcacgccccgggacttctatcacgaggaccatcggccgacgcatttcctcgagttc
agcaacatcgacgagggcgaggtcgcagaaggtgatagggaggacaccttcacgtaa

DBGET integrated database retrieval system