KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337906
Entry
4337906           CDS       T01015                                 
Name
(RefSeq) 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase isoform X1
  KO
K01103  6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 3 [EC:2.7.1.105 3.1.3.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4337906
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     4337906
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     4337906
SSDB
Motif
Pfam: 6PF2K His_Phos_1 CBM_20 AAA_33 KTI12 Zeta_toxin
Other DBs
NCBI-GeneID: 4337906
NCBI-ProteinID: XP_015640546
UniProt: A0A0P0WIQ8 Q0DKG9
LinkDB
Position
5:3763119..3771489
AA seq 773 aa
MGTSGSKGIDGVGGVGGGAAGLGGGEAGDGGGGVGGAASRSWHGGAQLYVSLKMENARIT
GDLVPHVYGSEPIIGSWDPARALAMERELASMWALSFVVPPDHETLDFKFLLKPKDADTP
CIIEEGPTRHLTGGMLEGDVRIAWFKMNGDHETLEFRVFNKADIVSPLDLAASWRVFKEN
FQPSKVRGIPDVSINVAPAHGTEDTSTESLELDLEHYVIPTPSAATSEYAANLAANPASL
IQTGALWTNDMLLSDGIQSPSSATADFEDHNNCNKDNVALPSDSFKKLQVSGIVESKSVD
TLTTLQKQDGQKGLFVDRGVGSTKFGKSSSACSLASGLNFGTGKQAMPEAAGAVAAAAVA
DRLHGSKEDRKLAIVLVGLPARGKTFTAAKLTRYLRWLGHETRHFNVGKYRRLKHGANQS
ADFFRDDNPEGIEARNEVAALAMEDMIDWMHGGGQVGIFDATNSTRKRRYMLMKMAEGNC
KIIFLETICNDPNIIERNVRLKIQQSPDYADQPDYETGVRDFKERLANYEKVYEPVQEGS
YIKMIDMVKGQGGQLQVNNISGYLPGRIVFFLVNSHLTPRPILLTRHGESLHNVRGRVGG
DTVLSEDGELYSKKLANFIEKRLKSEKTASIWTSTLQRTILTASPIVGFPKIQWRALDEI
NSGVCDGMTYEEIKKVMPEEFESRKKDKLRYRYPRGESYLDVIQRLEPVIIELERQRAPV
VVISHQAVLRALYAYFADRPLREVPDIEMPLHTIIEIQMGVTGVEEKRYKLMD
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggggacgtcggggtcgaaggggatcgacggcgtcgggggagtcggcggcggggcggcg
gggttggggggaggggaagcgggcgacggcggcggcggggtgggcggcgcggcgtcccgg
tcgtggcacggcggggcgcagctgtacgtgtcgctcaagatggagaacgcgcggatcacc
ggcgacctcgtcccgcacgtctacggctccgagcccatcatcggatcctgggaccccgcc
cgcgccctcgcgatggagagggagctggcgtccatgtgggcgctcagcttcgtcgtgccg
cctgaccacgaaacactcgacttcaaattcttgctcaagcccaaggatgcagacaccccg
tgcatcattgaggaaggtccgacccggcatctcactggaggcatgctcgagggcgatgtg
aggattgcatggttcaagatgaatggggatcatgagacgcttgagttcagggttttcaat
aaggcagacattgtgtccccacttgatcttgcagcgagttggagggtgttcaaggagaat
tttcagccttccaaagtccggggaatccctgatgtcagtataaatgtcgcacctgcgcat
gggaccgaggatacatctactgaaagtttggagcttgacttggagcattacgttattcca
acaccatctgcagcaacatctgaatatgcagcaaaccttgccgcaaacccagcatcattg
attcaaactggagctttatggacaaatgacatgcttctcagtgatggcatccagagtcca
agtagcgccactgcagattttgaagatcacaataactgtaacaaggataatgtggccttg
ccatcagattctttcaagaagttacaagtttctggaattgtagagtcaaaatcagttgac
accttaacaacactgcaaaagcaagatggacaaaagggactttttgtagacaggggtgtt
ggctctactaagtttggaaaatcatcaagtgcatgttccctggcttctggtcttaatttt
ggaacaggaaagcaggccatgccagaagcagcaggagctgttgcagctgcagctgtagct
gaccgattgcatgggtcaaaggaggaccgaaaactagctattgttttggttggcctacca
gctcgtggtaaaacttttaccgcagctaagcttacaaggtaccttcgttggttaggtcat
gaaaccagacatttcaatgttggaaagtaccgccgcctgaagcatggagcaaatcagtct
gcagattttttccgtgatgataaccctgaagggattgaggcacgcaatgaggtggctgct
ttagctatggaggacatgatagattggatgcatgggggaggacaggtcggtatatttgat
gcgacaaacagcacaagaaaacgaaggtatatgctaatgaaaatggctgaagggaactgt
aagattatatttctggaaactatctgtaacgatccgaatataattgaaaggaatgtacgt
ctgaagatacagcaaagtcctgactatgctgaccagccagattatgaaactggagtgcgg
gacttcaaggaacgcctggcaaactatgaaaaggtgtatgagccagtgcaggaaggttct
tacattaaaatgattgatatggtaaaagggcagggaggccagttacaggtcaacaatatc
agtggttatctccctggaaggattgtctttttcttggtgaactctcatcttacacctcga
cctattttgcttacaaggcatggtgagagtttacacaatgtcagaggaagagttggtggt
gacacggtcctgagtgaagatggagagctttactcgaagaaattagccaacttcatagaa
aagaggctcaaatctgagaaaactgcatctatatggaccagcacgcttcagaggacaatt
ttgacagcaagtccaatagttggattcccaaagatacaatggcgtgctcttgatgagata
aactctggggtgtgtgatgggatgacgtatgaagagataaagaaagttatgcccgaggaa
tttgaatcacgcaagaaggacaaattaagatatcgatacccccgtggagaatcttacctt
gatgtgattcagagactggaacctgttatcattgagctagaacgccagcgagcaccagta
gtcgttatttcccaccaggctgtattgcgggcgctatatgcatatttcgctgacaggcct
ctgagggaagtcccagatattgagatgcctctccacaccataattgagatacaaatggga
gtcacaggtgttgaggagaagaggtacaagctcatggactga

DBGET integrated database retrieval system