KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338045
Entry
4338045           CDS       T01015                                 
Name
(RefSeq) diacylglycerol O-acyltransferase 1 isoform X1
  KO
K11155  diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4338045
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     4338045
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     4338045
    2.3.1.76  retinol O-fatty-acyltransferase
     4338045
SSDB
Motif
Pfam: MBOAT MBOAT_2
Other DBs
NCBI-GeneID: 4338045
NCBI-ProteinID: XP_015639406
UniProt: Q5I396
LinkDB
Position
5:5971776..5978617
AA seq 538 aa
MVGSDGDGDGGGGEAHAPAAPAHHHRRPPRPRGGSGAIVEGFAAALRRRIRSGAAAAARA
SFGGDSGDEAASGEPSSSSSSSPSRRRGGDSNGAEASSAAGGGGGRGGGGDFSAFTFRAA
APVHRKAKESPLSSDAIFKQSHAGLFNLCIVVLVAVNSRLIIENLMKYGLLIRAGFWFND
KSLRDWPLLMCCLSLPAFPLGAFAVEKLAFNNVITDAVATCLHIFLSTTEIVYPVLVILK
CDSAVLSGFLLIFIACIVWLKLVSFAHTNHDIRQLTMGGKKVDNELSTVDMDNLQPPTLG
NLIYFMMAPTLCYQPSYPRTSCVRKGWLIRQIILYLIFTGLQGFIIEQYINPIVVNSQHP
LKGGLLNAVETVLKLSLPNVYLWLCMFYAFFHLWLSILAEILRFGDREFYKDWWNAKTID
EYWRKWNMPVHKWVVRHIYFPCMRNGISKEVAVLISFLVSAVLHEICVAVPCRILKFWAF
LGIMLQIPLIVLTAYLKSKFRDTMVGNMIFWFFFCIYGQPMCLLLYYHDVMNRIEKAR
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggtgggctccgatggcgacggcgacggcggcggaggggaagcacacgcgccggcggcg
cccgcgcaccaccaccgccggcccccgcgcccgcggggaggcagcggggccatcgtcgag
ggcttcgcggcggcgctccgtcgcaggatccgctcgggggccgcggcggccgcgcgggcc
agcttcgggggcgactccggggacgaggccgcctccggggagccctcctcgtcctcgtcc
tcgtccccgtcccgccgccgtggcggcgactccaacggggcggaggcgtcctccgccgcc
gggggcggtggtggccgtggcggcggtggggacttctccgcgttcacgttccgcgcggcg
gcgccggtgcaccgcaaggccaaggagagccccctcagctccgacgccatcttcaagcag
agtcatgcaggccttttcaacctatgcattgttgttctagttgcagtgaacagcaggctt
attatcgagaacttaatgaagtatggcttattaataagagctgggttttggtttaatgat
aaatcattgcgggactggccacttctaatgtgttgtcttagtctgcctgctttccccctg
ggtgcatttgcagttgaaaagttggcatttaacaatgttattactgatgctgttgctacc
tgcctccatatcttcctttcaacaaccgaaattgtatatccagtgcttgtgattcttaag
tgtgattctgcagttttgtctggctttttgttgatatttattgcctgtattgtttggctg
aagcttgtatcttttgcacatacaaaccatgatataaggcaactgaccatgggcggcaag
aaggttgataatgaactaagcacagttgacatggataatttacaacctccaactttaggg
aatctaatatacttcatgatggctcctacactctgttatcagccaagctatccccgaact
tcatgtgttagaaaaggttggctgattcgtcaaattattctgtacttgatctttactggt
cttcaaggcttcattattgagcaatacataaatccaattgttgtgaattctcagcatcca
ttgaaaggaggactcctaaatgctgtagagactgttttgaaactctcattaccaaatgtt
tacctgtggctttgcatgttctatgcttttttccatctctggttaagtatacttgctgag
attcttcgatttggtgaccgtgaattctacaaagattggtggaatgcaaaaacaattgat
gagtattggagaaaatggaatatgcctgtacataaatgggttgttcgccatatttacttt
ccttgcatgcgaaatggtatatcaaaggaagttgctgtcttgatatcattccttgtttct
gccgtactccatgagatatgtgtcgctgttccctgccgcattctcaagttctgggcattc
ttaggaataatgctacagatcccccttatcgtattgacagcatacctcaaaagtaaattc
agagatacaatggttggcaacatgatattttggttctttttctgcatctatgggcagcca
atgtgccttctcctgtactatcatgatgtgatgaacaggattgagaaggcaagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341317
Entry
4341317           CDS       T01015                                 
Name
(RefSeq) diacylglycerol O-acyltransferase 1
  KO
K11155  diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4341317
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     4341317
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     4341317
    2.3.1.76  retinol O-fatty-acyltransferase
     4341317
SSDB
Motif
Pfam: MBOAT MBOAT_2
Other DBs
NCBI-GeneID: 4341317
NCBI-ProteinID: XP_015641041
UniProt: A0A0P0WY03
LinkDB
Position
6:21677345..21684418
AA seq 477 aa
MAPPPSLAPDRGGGEPDDALRLRARAAAAAGDAPAPQQQQEQRHQEQQQQLLWYRASAPA
HRRVRESPLSSDAIFRQSHAGLLNLCIVVLVAVNSRLIIENLMKYGLLIRAGFWFSGTSL
ADWPLLMCCLTLPTFPLAALMVEKLAQRKLISKHVVILLHIVITTSVLVYPVVVILKCDS
AVLSGFVLMFLASIIWLKLVSFAHTNYDIRMLSKSIEKGVTHDISIDPENIKWPTFKRLS
YFMLAPTLCYQPSYPRTTYIRKGWVVRQLIKCLVFTGLMGFIIEQYINPIVKNSKHPLKG
NFLNAIERVLKLSVPTLYVWLCMFYCFFHLWLNILAELLCFGDREFYKDWWNAKTVEEYW
RMWNMPVHKWVIRHIYFPCIRNGFSKGVAILISFLVSAAFHELCVAVPCHIFKFWAFIGI
MFQIPLVFLTKYLQDKFNNTMVGNMIFWFFFSILGQPMCVLLYYHDVMNRQQAQTNR
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggccccgcccccctcgctcgcccccgatcgcggcggcggcgaacccgacgacgccctc
cgcctgcgggcccgcgccgccgccgccgccggtgacgctcccgctccgcagcagcagcag
gagcagaggcatcaggagcagcagcagcagctgctctggtaccgcgcgtcggcgcccgcc
caccgccgcgtcagggagagccccctcagctccgacgccatcttccgccagagccatgca
ggccttctgaacctatgcattgttgtgctggttgctgtgaacagcagacttattattgag
aatttaatgaagtatggcctactaattagagctggattttggtttagtggaacatcgctg
gcagattggcctcttctcatgtgctgtctcactttaccaactttcccgcttgctgcactt
atggttgagaagttggctcaaagaaaacttattagtaaacatgtggttattcttctccat
atcgttattacaacatctgtccttgtctatccagttgttgtgattctaaagtgtgattcg
gcagtattatctggatttgtgttgatgtttcttgcaagcattatttggttgaagcttgtt
tcttttgctcatacaaattatgatataagaatgctgtccaaaagtattgaaaagggcgtg
acacatgacatttctatagatccggagaacattaaatggccaacctttaaaaggctatcc
tacttcatgttggccccaacactttgttaccagccaagttatccccgaactacatatatt
agaaaaggttgggtggtccgacaactgataaaatgccttgtttttacaggcttgatgggt
tttataattgagcaatacataaatccaattgtgaagaattcgaagcatccattgaaaggg
aatttcttgaatgctatagagagagtattgaaattatcagtgccaacattatatgtctgg
ctttgcatgttctactgttttttccatctctggttgaatattcttgctgagctcctctgt
tttggtgatcgtgaattctacaaggactggtggaatgccaaaacagttgaagagtattgg
agaatgtggaatatgcctgttcacaagtgggtcattcgacatatatattttccatgcata
aggaatggtttttcaaagggtgttgctatcctaatctcgttcctggtttcagctgcattt
catgagctatgtgttgctgttccatgccacatttttaaattctgggcatttattgggatc
atgtttcagattcccctggtattcttgacgaaataccttcaagataaattcaataacaca
atggtgggcaacatgatattttggttcttcttcagcatcctggggcaaccaatgtgtgtt
ctcttatactaccatgatgtcatgaacaggcaacaagcccaaacaaatagatag

DBGET integrated database retrieval system