KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338052
Entry
4338052           CDS       T01015                                 
Name
(RefSeq) general transcription factor IIH subunit 5
  KO
K10845  TFIIH basal transcription factor complex TTD-A subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4338052
  09124 Replication and repair
   03420 Nucleotide excision repair
    4338052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4338052
   03400 DNA repair and recombination proteins [BR:osa03400]
    4338052
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4338052
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4338052
SSDB
Motif
Pfam: Tfb5
Other DBs
NCBI-GeneID: 4338052
NCBI-ProteinID: XP_015638314
UniProt: A0A8J8XNP4 B9FMY7
LinkDB
Position
5:6135089..6136748
AA seq 81 aa
MVAFCSPKSRNMVNAIKGLFISCDVPMAQFIVNLNASMPASDKFILHMLDPTHMFVQPHV
AEMIRGKISEFRDQNSYEKPT
NT seq 246 nt   +upstreamnt  +downstreamnt
atggtggcattctgttctccaaagagcagaaacatggttaatgcaataaaggggttgttc
atctcctgcgatgtaccgatggcacagttcattgttaatctgaatgcttcaatgcccgct
tcggacaagttcatcctgcacatgcttgaccctacacacatgtttgtgcagcctcatgtg
gcggagatgatcagaggtaagatatcagagttcagagaccaaaacagctacgagaagcca
acatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343686
Entry
4343686           CDS       T01015                                 
Name
(RefSeq) general transcription factor IIH subunit 5
  KO
K10845  TFIIH basal transcription factor complex TTD-A subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4343686
  09124 Replication and repair
   03420 Nucleotide excision repair
    4343686
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4343686
   03400 DNA repair and recombination proteins [BR:osa03400]
    4343686
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4343686
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4343686
SSDB
Motif
Pfam: Tfb5
Other DBs
NCBI-GeneID: 4343686
NCBI-ProteinID: XP_015645359
UniProt: Q0D591 Q6ZL18
LinkDB
Position
7:complement(23185311..23186941)
AA seq 131 aa
MPDLRLRSSALSRAPPPPPLQAPCSSPVCSYRSVQRRTGAREDNSTGRRQRWHSVLQRAE
NMVNAIKGLFISCDVPMAQFIVNLNASMPASDKFILHMLDPTHMFVQPHVAEMIRSKISE
FRDQNSYEKPT
NT seq 396 nt   +upstreamnt  +downstreamnt
atgcctgacctccgcctccgatcctccgccctgagccgcgcgccgccgccgccgccgctg
caggctccttgttcctcgccggtttgctcgtatcgctccgtacaacgacgcaccggtgct
agagaagacaacagcacagggaggcgacaaaggtggcattctgttctccaaagagcagaa
aacatggttaatgcaataaaggggttgttcatctcctgcgatgtaccgatggcacagttc
attgttaatctgaatgcttcaatgcccgcttcggacaagttcatcctgcacatgcttgac
ccgacacacatgtttgtgcagcctcatgtggcggagatgatcagaagtaagatttcagag
ttcagagaccaaaacagctacgagaagccaacatga

DBGET integrated database retrieval system