KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338298
Entry
4338298           CDS       T01015                                 
Name
(RefSeq) crooked neck-like protein 1 isoform X1
  KO
K12869  crooked neck
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4338298
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4338298
   03036 Chromosome and associated proteins [BR:osa03036]
    4338298
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4338298
 Complex C
    4338298
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4338298
SSDB
Motif
Pfam: TPR_14 HAT Suf TPR_19 TPR_17 TPR_16 TPR_6 TPR_2 Wzy_C_2 Mad3_BUB1_I TPR_9 TPR_11
Other DBs
NCBI-GeneID: 4338298
NCBI-ProteinID: XP_015640151
UniProt: Q0DJG2 Q75HS3
LinkDB
Position
5:complement(12601141..12606127)
AA seq 723 aa
MALITPASGGGGGGGDKAPPSASDPSLGFLTKRDTEVKLPRATRVKNKTPASVQITAEQI
LREARERQEPEIRPPKQKITDSIELSEYRLRRRKEFEDVIRRVRWNVNAWVKYAKWEEQQ
RDFARARSVYERALDVAHRDHTLWLKYAEFEMRNRFVNHARNVWDRAVSLLPRVDQLWYK
YIHMEELLGAVANARQVFERWMAWRPDTAGWNSYIKFELRYGEVERARAIYERFVAEHPR
PDTFIRYAKFEMKRGEVERARQVYQRAADLLADDEDAQVLFVAFAEFEERCREVERARAI
YKYALDRVPKGQAEELYRKFLAFEKQFGDREGIEDAIVGKRRFQYEDEVRKNPLNYDSWF
DYIRLEESVGNNDRIREVYERAIANIPPADEKRYWQRYIYLWINYALYEELDAKDVERTR
EVYSECLKLVPHKKFTFAKMWLMAAQFEIRQRNLKAARQILGNAIGMSPKGKIFKKYIEI
ELYLGNFDRCRTLYEKYIEWSPANCYAWRKYAELEKNLSETDRARSIYELAIAQPALDTP
EVLWKEYLQFEIDENEFDRTRELYERLLDRTKHLKVWISYTEFEASAGLAGEDGESEEIK
KEVSYHEQQIERVRRCRAIFERAFEYFRTSAPELKEERAMLLEEWLNKEVSFGDLGDVTL
VQKKAPRKVKRKRPIPTEDGSTVAYEEYIDYIFPDEVALAPNLKILEAAYKWKKQKTDDT
DDV
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggcgctcatcaccccagctagcggcgggggcggcggcggaggagacaaagccccaccg
tccgcctccgacccgagcctcgggttcctcactaagcgcgacacggaggtgaagctgccc
cgggcgacgcgggtgaagaacaagacccccgcctcggtccagatcaccgcagagcagatc
ctccgggaggcgcgggagcggcaggagcccgagatccgcccgcccaagcagaagatcacc
gactcaatcgagctctccgagtaccgcctccgccgccgcaaagagttcgaggacgtcatc
cgccgcgtccgatggaacgtcaacgcctgggtcaagtacgccaagtgggaggagcagcaa
cgggacttcgcccgcgcgcgctccgtctacgagcgcgccctcgacgtcgcccaccgcgac
catacgctctggctcaagtacgcagagttcgagatgcgcaacaggttcgtcaatcatgcc
cgcaacgtctgggaccgcgccgtttctctcctaccccgggtggaccagctgtggtacaag
tacatccacatggaggagctacttggcgctgttgccaacgcccgccaggtgttcgagcgc
tggatggcctggcgtcctgacacagctggctggaactcgtacatcaaatttgagctgcgc
tatggtgaggtggagcgggcaagagctatttatgagcggtttgtggctgaacacccacga
ccagatacgttcattcgatatgccaagtttgagatgaagcgtggagaagtggagcgcgcg
cggcaggtgtaccagcgtgctgcagacctgctcgcagatgatgaggatgcccaggtgctg
tttgtagcctttgctgagtttgaggaaaggtgccgggaggttgagcgtgcccgagctata
tacaagtatgcacttgatagggtgcccaaaggccaggctgaggagctgtacaggaagttc
cttgcatttgaaaaacagtttggtgaccgtgaaggaattgaggatgccatcgtgggtaag
aggagattccagtatgaggacgaggtgaggaagaaccctctcaattatgattcatggttt
gattacattaggctggaggagagtgttgggaacaatgacaggatcagggaggtgtatgag
agagccattgctaatatccccccagcagatgagaagcgttactggcaacgatacatttac
ctatggataaattatgctttgtatgaggagcttgatgcaaaggacgtggaacggaccagg
gaagtttacagcgagtgtctcaaattggttccacacaagaaattcacttttgccaagatg
tggctcatggcagcccagtttgagataaggcaaaggaatcttaaagctgcacggcagata
ctcggaaatgccattgggatgtctccaaagggcaagatattcaaaaagtacattgagatt
gagttgtatcttggtaattttgaccgttgtaggactctctatgagaagtatattgaatgg
tctccagcaaactgttatgcctggaggaagtatgctgaattagagaagaaccttagtgag
actgatcgtgctcgttccatatatgagcttgctattgctcagccagcccttgatacacca
gaagttttgtggaaggagtacttgcagtttgaaattgatgaaaatgaattcgataggact
cgcgaactatacgagagattgcttgatagaacaaaacatttgaaggtatggataagctat
accgagtttgaggcctcggctggtttggctggggaagacggtgagagtgaggagattaag
aaagaagttagttatcatgaacagcagatagaacgggttcgaaggtgccgagcaatcttt
gaaagagcattcgaatacttcagaactagtgctccagagttaaaggaggaaagagcaatg
ctccttgaagaatggcttaacaaggaggtgagctttggtgaccttggtgatgtcacctta
gtgcagaaaaaggcgccaaggaaagtgaagagaaagagaccaattcctacagaggatggc
tccactgttgcgtatgaagagtacattgattatattttccccgatgaggttgcgctggct
ccaaacctcaagatccttgaagcagcctataagtggaagaagcagaagacagatgatact
gatgatgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342038
Entry
4342038           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor syf2
  KO
K12868  pre-mRNA-splicing factor SYF2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4342038
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4342038
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4342038
 Complex C
    4342038
SSDB
Motif
Pfam: SYF2 Vanabin-2
Other DBs
NCBI-GeneID: 4342038
NCBI-ProteinID: XP_015644493
UniProt: Q0D9K8 Q5Z7Y7
LinkDB
Position
6:30087160..30089540
AA seq 340 aa
MASSSSAASGKSRPECINSSNPFHECSDYCLRKIAEAKERIEDEQRPPVDRTVHPDCINA
SNPYHVCSEYCFKRIADAKSGLERAEQEPPSADAGKSDAAQAEGGGGDDDAEQEDAGSDD
GYPQMTEKQKKLFELRLKMNEARKANQQAMVAEKKRMEPRAESRGVSKQKWLEDRKKKIG
KLLDSNGLDMTKSYMLDTQESAEAKYKKWEKEPAPYGWDVFNQKTLYDAYKKRTKNIEVD
MEAYNKAKEADPEFYRDASSLQYGKVSKVPEENIDRMVNELKERDEKRKAFSRRRKFHED
KDIDSINDRNEHFNKKVERAFGKYTLEIKNNLERGTALPD
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggcgtcgtcgtcgtcggcggcgtcggggaagtcgcggccggagtgcatcaactcgtcg
aacccgttccacgagtgctccgactactgcctccgcaagatcgccgaggccaaggagcgc
atcgaggacgagcagcggccgccggtggaccgcaccgtccaccccgactgcatcaacgcc
tccaacccctaccacgtctgctccgagtactgcttcaagaggatcgccgacgccaaatca
gggttggagcgtgcggagcaagaaccgccttctgcagacgctggcaaatccgacgctgcc
caagctgagggtggtggtggtgatgatgatgcggagcaggaggacgccggctcagacgac
ggttacccgcagatgacagagaagcagaagaagctatttgagttgcggctgaagatgaat
gaagctaggaaggcaaatcagcaagcgatggtggcagagaagaagaggatggagcctcgc
gctgagagtagaggtgtttctaaacaaaagtggctggaagacagaaaaaagaagatcgga
aagcttcttgactcaaatggcctggacatgacaaagtcttacatgctcgatacacaggag
tcggccgaagcaaaatacaagaagtgggaaaaggaacctgcaccatatggttgggatgtt
ttcaaccagaagaccttatatgatgcatacaaaaagaggaccaagaacattgaggttgac
atggaggcatacaacaaagcaaaggaagccgatcctgaattttatcgggacgcttcaagt
ctccaatatgggaaggtgtctaaggtcccggaagaaaacatagacaggatggttaatgag
cttaaggaacgggatgagaaacggaaagcattcagcaggaggcgcaagttccatgaagac
aaggacattgactcgatcaatgaccggaacgaacacttcaacaagaaggttgagagggca
tttggcaagtatactcttgagatcaagaacaatcttgaaagggggactgccttgccagat
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344088
Entry
4344088           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor SYF1
  KO
K12867  pre-mRNA-splicing factor SYF1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4344088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4344088
   03041 Spliceosome [BR:osa03041]
    4344088
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4344088
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4344088
 Complex C
    4344088
SSDB
Motif
Pfam: TPR_14 Mad3_BUB1_I TPR_15 TPR_8 TPR_12 Suf TPR_5
Other DBs
NCBI-GeneID: 4344088
NCBI-ProteinID: XP_015647551
UniProt: A0A0P0X9Y1 Q8LIB1
LinkDB
Position
7:complement(26819292..26824258)
AA seq 931 aa
MPSPAGGPVAVAAASAAAAEALGISPEMYPTEDDLAYEEEILREPFKLKGWWRYLVARAA
APFAKRAVIYERALKALPGSYKLWHAYLRERLDHARPHPISHHAYASLNNTFERALATMH
KMPRVWVLYLTSLLDQRLLTRARRAFDRALRALPVTQHDRIWPLYLRLASLPACPVETSL
RVFRRYLQYDPSHAEDFIDFLISANRWQEAADRLASVLNDDGFRSVKGKTQHQLWLELCE
ILTKHADEVAGLKVDAILRGGIRKFTDEVGKLWTSLADYYVRRTLYEKARDVFEEGVASV
MTVQEFSVVFEAYTQFEQSMLAAKLEAAEEEGAGSEGEEEAGRKNGMDKLSKKFLADCWL
NDEDDTDLRLARFERLLDRRPELLSSVLLRQNPHNVEEWHRRVKLFEKDPTRQVATYVEA
VKTVDPMKAAGKPHTLWVAFAKMYEKHNRLDSAEEIFKKATQVNYKAVDHLASIWCEWAE
MELRHSNFDKAIELMRQATAEPSVEVKRRAAAEGDEPVQLKVHKSLKLWSFYVDLEESLG
TLESTRAVYERILDLRIATPQIVLNYAYLLEENKYFEDAFKVYERGVKIFKYPHVKDIWV
TYLTKFVRRYQRSKLERARELFDEAVKQAPPQEKKVLYLQYAKLEEDYGLAKRAMNVYDE
AVRAVPNSEKMSMYEIYIARAAELFGVPRTRQIYEQAIESGLPDRDVMTMCMKFAELERN
LGEIDRARAIYVHASNYADPNSHPEFWNKWNEFEIQHGNEDTFREMLRIKRTVAASRSQT
HFILPEYLMQRDQRLNLDEAVDTLKRAGVPEDEMANLERQLAPGPSTAPPAPSTATAPAN
RMMNFVSAGVQAQAESSSRQQQAAATNNEDIELPDESDEEEDDVQIAEKSVPAAVFGELG
KRAAENREEESSGAQENEQLGALERIKRRRQ
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgccgtcgcctgcggggggtccggtggccgtggcggcggcgtctgcggcggcggcggag
gcgctggggatctcgccggagatgtacccgacggaggacgacctggcgtacgaggaggag
atcctgcgcgagccgttcaagctcaaggggtggtggcgctacctcgtcgcccgcgccgcc
gcgccgttcgccaagcgcgccgtcatctacgagcgcgcgctcaaggcgctcccggggagc
tacaagctgtggcacgcctacctccgcgagcgcctcgaccacgcgcgcccgcaccccatc
tcccaccacgcctacgcctccctcaacaacaccttcgagcgcgccctcgccaccatgcac
aagatgccccgcgtctgggtgctctacctcacctcgctgctcgaccagcgcctgctcacg
cgcgcgcgccgcgccttcgaccgcgcgctgcgcgcgctccccgtcacgcagcacgaccgc
atctggccgctctacctccgcctcgcctcgctcccggcctgccccgtcgagacctcgctc
cgcgtcttccgacgatacctccagtacgacccctcccacgctgaggacttcatcgatttc
ctcatctccgcaaaccgctggcaggaggccgccgaccgcctcgcgtccgtgctcaacgat
gacggcttccgctccgtcaagggtaagacccagcaccagctctggcttgagctctgcgaa
atcctcaccaagcatgccgatgaggttgcggggctcaaggtggacgctatactgcggggc
ggcattcgcaagttcaccgatgaggttggcaagctgtggacctccctggccgattactac
gtcagaagaaccttgtatgagaaggcgagggatgtcttcgaagagggggttgcttcggtg
atgacggtgcaggaattcagcgtggtgtttgaggcgtacacacaattcgagcagagtatg
cttgcggcaaagctggaggcagccgaggaggagggtgcggggagtgagggggaagaggaa
gcgggcaggaagaatgggatggacaagctgtcgaagaaattcctcgcagattgctggctg
aatgatgaggatgatactgatttgaggctggcaaggtttgagcggctgttggatcgccgg
ccagagctcctcagcagtgtcctgctgcgacagaatccgcataatgtggaggaatggcac
aggagggtgaaactttttgagaaggatcctacaaggcaagtagccacatatgttgaagct
gtgaaaaccgtagaccctatgaaggcagctggaaaaccacatactctatgggtggcattc
gcaaagatgtatgagaaacataatcgtctagatagtgctgaagagatctttaaaaaagca
acacaggtgaactacaaggcagttgaccacttagccagtatttggtgtgagtgggcagag
atggagctgaggcacagtaattttgacaaggctattgagctgatgaggcaagctactgca
gaaccctctgttgaggttaagaggcgagctgctgctgagggggatgaacctgtccaattg
aaagtacataaatccctgaaactgtggagcttctatgtggacctggaggaaagtcttgga
acattggaatcaactcgtgcagtttatgagagaatattggatttacgaattgccactccc
caaatagttctcaattatgcatatcttcttgaggaaaacaagtatttcgaagatgcgttt
aaagtgtatgagcgtggtgtgaaaatttttaaatatccccatgttaaagacatttgggtg
acctacctcacaaagtttgtaagaaggtatcagagaagcaagttagagcgggcaagagaa
ctgttcgatgaagctgtcaaacaggctcctccacaagaaaagaaggtattgtatttgcag
tatgctaagctggaggaagactatggccttgcgaaacgtgcaatgaatgtatacgacgaa
gctgtaagggctgttcctaacagcgaaaagatgagtatgtacgaaatatatattgcacgg
gctgcggagctatttggtgttccaagaacaagacagatatatgagcaagcaattgaatct
ggactcccagacagagatgtcatgacaatgtgcatgaaatttgcagaacttgaaagaaac
cttggagaaattgatcgtgcccgtgccatttatgtccacgcatccaactatgctgatcca
aactctcatcctgaattttggaataaatggaatgaatttgagattcagcatggtaacgaa
gatacattcagggagatgcttcgcatcaagcgtactgtggctgctagccgcagtcagact
catttcatactcccagagtacttgatgcagagggaccagaggctgaacctcgatgaggca
gttgacactctgaaacgagccggtgttcctgaggatgagatggctaacctagaaaggcaa
ctagcgccaggaccttccacggctccaccagctccaagcactgctactgctcctgctaac
cggatgatgaactttgtcagtgctggagtgcaggcacaggctgagagcagcagcaggcaa
caacaggctgctgctactaacaatgaggacattgagctgcccgatgagagcgacgaggag
gaagacgatgtccaaattgcggagaagagtgttcccgctgcggtgtttggagagctcggc
aagagagctgcagagaacagggaggaggaaagctctggtgcccaggagaatgagcagctt
ggcgcccttgagaggattaagcgaaggcgtcaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348330
Entry
4348330           CDS       T01015                                 
Name
(RefSeq) crooked neck-like protein 1
  KO
K12869  crooked neck
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4348330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4348330
   03036 Chromosome and associated proteins [BR:osa03036]
    4348330
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4348330
 Complex C
    4348330
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4348330
SSDB
Motif
Pfam: TPR_14 HAT Suf TPR_19 TPR_17 TPR_15 TPR_12 TPR_16
Other DBs
NCBI-GeneID: 4348330
NCBI-ProteinID: XP_015613378
UniProt: Q0IYE2 Q8S5Y7
LinkDB
Position
10:9212923..9215363
AA seq 711 aa
MLPTPRRVKNKAPAPVQLTAEHLIREARELHGDGSVTVCLPAESKKRRIVDADELAEHRL
ERRARFEAIVRRAGSGRGGCGDASSEWMRYARWEESPGGGGGDPARARSVYERALAGGAP
AYRDHGVWIKYAQFEARGGRVGHARNVLDRAVAILPRADRIWSEYLRMEDLLGATDNARV
VFDRWTSWRPGADAWAAYAAFELRHGELDRARAVHERHVAALPCADAFILFAEFETKLKN
LDRAPRVYEHAGSLLAAAGDNDDTAVLLAAFADFEERCGEPDRARAIYQHALRGEPPEPR
AEELREKLLSLEKRFGDRHGVEDSIVTKRRSQYERAVTTNPLCYDAWFDLIRLEESANTG
DANRIRDLYRRAVANVPPAAAAAEKRHWRRYIYLWINYALFEELDAEDVARARGVYRECL
RTIPHKKFSFSNICVMAAELEIRDKNLAAARRLLGNAIGVAPRPKLSRRYIEIELQLGNV
GRCRILSQKFIEHAPSSSHVWRSYAALEKKLGETDRARSVYDLAVSQPALDAPELVWTDY
IQFEIDAGELDRARQLYERLLGKTQHLNVWVSYAEFEATACSGGAAIAGNAAEKAERVRR
CRAVCRRADEHFRGCADDPAMKEARAMLLQQWLAKEAAFGDLGEVEPVEKKTPRRVKRKR
SLLADGNGGGGGCEEFFDYIFGDEEDATAAAGFKLMKAAYEWKNSGHVITY
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgctgccgaccccccgccgcgtcaagaacaaagcaccggcgcccgtgcagctcacggcc
gagcatctcatccgtgaggcccgcgaactgcacggcgatggatcggtgaccgtctgcctg
ccggcggagtccaagaagaggaggatcgtcgatgccgacgagctcgccgagcaccggctc
gagcgacgcgcacggttcgaggccatcgtccgccgagccggcagcggtcgcggaggatgc
ggcgacgcgtcgtcggagtggatgaggtacgcgcggtgggaggagtcccccggcggcggc
ggcggcgaccccgcccgcgcgcgatccgtgtacgagcgcgcgctggccggcggcgcgccg
gcgtaccgcgaccatggtgtgtggataaagtatgcgcagttcgaggctcgtggcggccgc
gtcgggcacgcgcgcaacgtacttgaccgcgccgtggcgatcctcccgcgcgctgaccgc
atctggtcggagtacctccgcatggaggatctcctcggcgccacagacaacgcccgcgta
gtgttcgataggtggacgtcttggcgccccggcgccgatgcctgggccgcgtacgccgcg
ttcgagctccgccacggcgagctggaccgtgccagagccgtgcacgagcggcatgttgct
gctctcccgtgcgccgacgcgttcatccttttcgccgagttcgagacgaaactgaagaac
ctggaccgcgcgccccgcgtgtacgagcacgccgggagcctgctcgccgccgccggcgac
aacgacgacaccgccgtgctgctcgccgcgttcgccgacttcgaggagcggtgcggggag
ccggaccgagcgcgtgcaatataccagcacgcgctccgtggcgagccgcccgagccccgc
gccgaggagctgcgcgagaagctcctctctctcgagaagcggttcggcgaccgccatggc
gtcgaggacagcatcgtcaccaagcggaggtcccagtacgagcgcgcggtgaccacgaac
ccgctgtgctacgacgcgtggttcgacctcatcaggctggaggagagcgccaacaccggc
gacgcgaaccggatcagggacctctacaggcgcgccgtcgccaacgttccaccggcggcg
gcggcggcggagaagcggcattggcggcggtacatctacctctggatcaactacgccctc
ttcgaggagctcgacgcggaggacgtggcgcgcgcccgcggcgtgtaccgggagtgcctc
aggacgatcccacacaagaagttctccttctccaatatctgcgtcatggcggcggagctc
gagatccgtgacaagaacctcgccgcggcgcggcggctcctcggcaacgcgatcggcgtc
gcgccccggccgaagctatccaggaggtacatcgagatcgagctccagctcggcaacgtc
ggccggtgccggattctgtcccagaagttcatcgagcacgctccgagcagcagccacgta
tggagaagctacgccgcgttggagaagaagctgggcgagaccgaccgcgcccgatccgta
tacgacctcgccgtctctcagccggcgctggacgccccggagctagtgtggacggactac
atccagttcgagatcgacgccggcgagctcgacagagcgaggcagctctacgagaggctt
ctcggcaaaacacaacacctcaacgtgtgggtgagctacgccgagttcgaggccacggcg
tgctccggcggcgccgccatcgccgggaacgcggcggagaaggccgagcgggtccggagg
tgccgcgccgtatgccgaagagcggacgaacacttcaggggatgcgctgatgatcccgcc
atgaaggaggcaagggcgatgcttctccaacaatggctggcgaaggaggccgcgttcggc
gacctcggagaggtggagccggtcgagaagaagacgccgagaagggtgaagaggaagagg
agtctcctcgccgacggcaatggcggaggaggaggatgcgaggagttcttcgattacatt
tttggtgatgaagaggatgcaacggcagcagctggcttcaaactgatgaaagctgcttac
gaatggaagaacagtggccatgttattacttattag

DBGET integrated database retrieval system