KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338303
Entry
4338303           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor IIA subunit 1 isoform X1
  KO
K03122  transcription initiation factor TFIIA large subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4338303
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4338303
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     4338303
SSDB
Motif
Pfam: TFIIA NOA36
Other DBs
NCBI-GeneID: 4338303
NCBI-ProteinID: XP_015640793
UniProt: Q0DJF8 A0A0N7KKG7
LinkDB
Position
5:12865909..12872403
AA seq 394 aa
MASSNVSTVYISVIDDVISKVRDDFISYGVGDAVLNELQALWEMKMLHCGAISGTIDRSK
AAPAPSAGTPGAGTTPPVHDLNVPYEATSEEYATPTADMLFPPTPLQTPIQTPLPGTDAG
MYNIPTGPSDYAPSPISDVRNGMAMNGADPKTGRPSPYMPPPSPWMTQRPLGVDVNVAYV
ENREDPDRTGQPPQLTKDFLMMSSGKRKRDEYPGQLPSGSFVPQQDGSADQIVEFVVSKD
NAQQLWSSIVNKQGTATKESSTKETIIAPTIPQRDGMDDYNDPFYFQGVPTEDYNTPGES
SEYRAPTPAVGTPKPRNDVGDDDEPPLNEDDDDDDELDDLEQGEDEPNTQHLVLAQFDKV
TRTKNRWKCTLKDGIMHLNGRDVLFNKATGEFDF
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggccagcagcaacgtctccacggtctatatctccgtcatcgacgacgtcatctccaag
gtccgcgacgacttcatctcgtacggcgtcggcgacgctgtcctcaacgagctccaggcg
ctctgggagatgaagatgctgcactgcggcgcaatctccgggaccatcgaccgctccaag
gcggctcccgcgccgtccgcaggcacccccggcgctggaaccaccccgccggtacacgac
ctaaacgtgccctacgaggccacctcggaggagtacgccacccccacagcggacatgctg
ttccccccgacgccgctacaaaccccgatccagacccctcttccaggaacagatgcaggg
atgtacaacattcccactgggccttcagactatgccccttccccgatcagtgacgtgagg
aatggcatggccatgaatggagctgatccaaagactggtcgcccgagtccctacatgcct
ccaccctctccctggatgactcagaggccgctgggcgttgatgtgaatgtcgcttatgtg
gagaaccgtgaggacccagataggaccggacagcctccgcaactaactaaggattttcta
atgatgtcctctgggaaacgcaagagggatgaatatcctggtcagctcccttctggttct
tttgtgccacaacaagatggaagtgcagatcagatagttgaatttgttgtctcaaaggac
aacgcacaacaactttggagttccattgtgaacaagcaaggaacagcaacaaaagaatct
tccacaaaggaaacaataattgctccaacgattcctcaacgggatgggatggatgactat
aatgatccattttacttccaaggagttccaactgaggattacaatacccctggagaatcg
tcggaataccgagctcccacaccggctgttggaacaccaaaaccgagaaatgatgtaggc
gatgatgatgagcctccgcttaatgaagatgacgatgatgatgatgagttagatgacctt
gagcaaggggaggatgagcctaacacacagcaccttgtcctcgcacagtttgacaaagtg
acaaggacaaagaaccgctggaaatgcactttgaaggatggaatcatgcatttaaatggc
cgagatgttctattcaacaaggctaccggcgaatttgatttttga

DBGET integrated database retrieval system