KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338322
Entry
4338322           CDS       T01015                                 
Name
(RefSeq) acetyl-CoA carboxylase 2
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00620  Pyruvate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4338322
   00640 Propanoate metabolism
    4338322
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4338322
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    4338322
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     4338322
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     4338322
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     4338322
SSDB
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp_3 ATP-grasp Dala_Dala_lig_C PCC_BT Peptidase_M29
Other DBs
NCBI-GeneID: 4338322
NCBI-ProteinID: XP_015639213
UniProt: B9FK36
LinkDB
Position
5:complement(13064185..13078039)
AA seq 2327 aa
MTSTHVATLGVGAQAPPRHQKKSAGTAFVSSGSSRPSYRKNGQRTRSLREESNGGVSDSK
KLNHSIRQGLAGIIDLPNDAASEVDISHGSEDPRGPTVPGSYQMNGIINETHNGRHASVS
KVVEFCTALGGKTPIHSVLVANNGMAAAKFMRSVRTWANDTFGSEKAIQLIAMATPEDLR
INAEHIRIADQFVEVPGGTNNNNYANVQLIVEIAERTGVSAVWPGWGHASENPELPDALT
AKGIVFLGPPASSMHALGDKVGSALIAQAAGVPTLAWSGSHVEVPLECCLDSIPDEMYRK
ACVTTTEEAVASCQVVGYPAMIKASWGGGGKGIRKVHNDDEVRTLFKQVQGEVPGSPIFI
MRLAAQSRHLEVQLLCDQYGNVAALHSRDCSVQRRHQKIIEEGPVTVAPRETVKELEQAA
RRLAKAVGYVGAATVEYLYSMETGEYYFLELNPRLQVEHPVTEWIAEVNLPAAQVAVGMG
IPLWQIPEIRRFYGMNHGGGYDLWRKTAALATPFNFDEVDSKWPKGHCVAVRITSEDPDD
GFKPTGGKVKEISFKSKPNVWAYFSVKSGGGIHEFADSQFGHVFAYGTTRSAAITTMALA
LKEVQIRGEIHSNVDYTVDLLNASDFRENKIHTGWLDTRIAMRVQAERPPWYISVVGGAL
YKTVTANTATVSDYVGYLTKGQIPPKHISLVYTTVALNIDGKKYTIDTVRSGHGSYRLRM
NGSTVDANVQILCDGGLLMQLDGNSHVIYAEEEASGTRLLIDGKTCMLQNDHDPSKLLAE
TPCKLLRFLVADGAHVDADVPYAEVEVMKMCMPLLSPASGVIHVVMSEGQAMQAGDLIAR
LDLDDPSAVKRAEPFEDTFPQMGLPIAASGQVHKLCAASLNACRMILAGYEHDIDKVVPE
LVYCLDTPELPFLQWEELMSVLATRLPRNLKSELEGKYEEYKVKFDSGIINDFPANMLRV
IIEENLACGSEKEKATNERLVEPLMSLLKSYEGGRESHAHFVVKSLFEEYLYVEELFSDG
IQSDVIERLRLQHSKDLQKVVDIVLSHQSVRNKTKLILKLMESLVYPNPAAYRDQLIRFS
SLNHKAYYKLALKASELLEQTKLSELRARIARSLSELEMFTEESKGLSMHKREIAIKESM
EDLVTAPLPVEDALISLFDCSDTTVQQRVIETYIARLYQPHLVKDSIKMKWIESGVIALW
EFPEGHFDARNGGAVLGDKRWGAMVIVKSLESLSMAIRFALKETSHYTSSEGNMMHIALL
GADNKMHIIQESGDDADRIAKLPLILKDNVTDLHASGVKTISFIVQRDEARMTMRRTFLW
SDEKLSYEEEPILRHVEPPLSALLELDKLKVKGYNEMKYTPSRDRQWHIYTLRNTENPKM
LHRVFFRTLVRQPSVSNKFSSGQIGDMEVGSAEEPLSFTSTSILRSLMTAIEELELHAIR
TGHSHMYLHVLKEQKLLDLVPVSGNTVLDVGQDEATAYSLLKEMAMKIHELVGARMHHLS
VCQWEVKLKLDCDGPASGTWRIVTTNVTSHTCTVDIYREMEDKESRKLVYHPATPAAGPL
HGVALNNPYQPLSVIDLKRCSARNNRTTYCYDFPLAFETAVRKSWSSSTSGASKGVENAQ
CYVKATELVFADKHGSWGTPLVQMDRPAGLNDIGMVAWTLKMSTPEFPSGREIIVVANDI
TFRAGSFGPREDAFFEAVTNLACEKKLPLIYLAANSGARIGIADEVKSCFRVGWSDDGSP
ERGFQYIYLSEEDYARIGTSVIAHKMQLDSGEIRWVIDSVVGKEDGLGVENIHGSAAIAS
AYSRAYKETFTLTFVTGRTVGIGAYLARLGIRCIQRLDQPIILTGYSALNKLLGREVYSS
HMQLGGPKIMATNGVVHLTVSDDLEGVSNILRWLSYVPAYIGGPLPVTTPLDPPDRPVAY
IPENSCDPRAAIRGVDDSQGKWLGGMFDKDSFVETFEGWAKTVVTGRAKLGGIPVGVIAV
ETQTMMQTIPADPGQLDSREQSVPRAGQVWFPDSATKTAQALLDFNREGLPLFILANWRG
FSGGQRDLFEGILQAGSTIVENLRTYNQPAFVYIPMAAELRGGAWVVVDSKINPDRIECY
AERTAKGNVLEPQGLIEIKFRSEELQDCMSRLDPTLIDLKAKLEVANKNGSADTKSLQEN
IEARTKQLMPLYTQIAIRFAELHDTSLRMAAKGVIKKVVDWEESRSFFYKRLRRRISEDV
LAKEIRAVAGEQFSHQPAIELIKKWYSASHAAEWDDDDAFVAWMDNPENYKDYIQYLKAQ
RVSQSLSSLSDSSSDLQALPQGLSMLLDKMDPSRRAQLVEEIRKVLG
NT seq 6984 nt   +upstreamnt  +downstreamnt
atgacatccacacatgtggcgacattgggagttggtgcccaggcacctcctcgtcaccag
aaaaagtcagctggcactgcatttgtatcatctgggtcatcaagaccctcataccgaaag
aatggtcagcgtactcggtcacttagggaagaaagcaatggaggagtgtctgattccaaa
aagcttaaccactctattcgccaaggtcttgctggcatcattgacctcccaaatgacgca
gcttcagaagttgatatttcacatggttccgaagatcccagggggcctacggtcccaggt
tcctaccaaatgaatgggattatcaatgaaacacataatgggaggcatgcttcagtctcc
aaggttgttgagttttgtacggcacttggtggcaaaacaccaattcacagtgtattagtg
gccaacaatggaatggcagcagctaagttcatgcggagtgtccgaacatgggctaatgat
acttttggatcagagaaggcaattcagctgatagctatggcaactccggaggatctgagg
ataaatgcagagcacatcagaattgccgatcaatttgtagaggtacctggtggaacaaac
aacaacaactatgcaaatgtccaactcatagtggagatagcagagagaacaggtgtttct
gctgtttggcctggttggggtcatgcatctgagaatcctgaacttccagatgcgctgact
gcaaaaggaattgtttttcttgggccaccagcatcatcaatgcatgcattaggagacaag
gttggctcagctctcattgctcaagcagctggagttccaacacttgcttggagtggatca
catgtggaagttcctctggagtgttgcttggactcaatacctgatgagatgtatagaaaa
gcttgtgttactaccacagaggaagcagttgcaagttgtcaggtggttggttatcctgcc
atgattaaggcatcttggggtggtggtggtaaaggaataaggaaggttcataatgatgat
gaggttaggacattatttaagcaagttcaaggcgaagtacctggttccccaatatttatc
atgaggctagctgctcagagtcgacatcttgaagttcagttgctttgtgatcaatatggc
aacgtagcagcacttcacagtcgagattgcagtgtacaacggcgacaccaaaagataatc
gaggaaggaccagttactgttgctcctcgtgagactgtgaaagagcttgagcaggcagca
cggaggcttgctaaagctgtgggttatgttggtgctgctactgttgaatacctttacagc
atggaaactggtgaatattattttctggaacttaatccacggctacaggttgagcatcct
gtcactgagtggatagctgaagtaaatttgcctgcggctcaagttgctgttggaatgggt
atacccctttggcagattccagagatcaggcgcttctacggaatgaaccatggaggaggc
tatgacctttggaggaaaacagcagctctagcgactccatttaactttgatgaagtagat
tctaaatggccaaaaggccactgcgtagctgttagaataactagcgaggatccagatgat
gggtttaagcctactggtggaaaagtaaaggagataagtttcaagagtaaaccaaatgtt
tgggcctatttctcagtaaagtctggtggaggcatccatgaattcgctgattctcagttc
ggacatgtttttgcgtatggaactactagatcggcagcaataactaccatggctcttgca
ctaaaagaggttcaaattcgtggagaaattcattcaaacgtagactacacagttgaccta
ttaaatgcctcagattttagagaaaataagattcatactggttggctggataccaggata
gccatgcgtgttcaagctgagaggcctccatggtatatttcagtcgttggaggggcttta
tataaaacagtaactgccaacacggccactgtttctgattatgttggttatcttaccaag
ggccagattccaccaaagcatatatcccttgtctatacgactgttgctttgaatatagat
gggaaaaaatatacaatcgatactgtgaggagtggacatggtagctacagattgcgaatg
aatggatcaacggttgacgcaaatgtacaaatattatgtgatggtgggcttttaatgcag
ctggatggaaacagccatgtaatttatgctgaagaagaggccagtggtacacgacttctt
attgatggaaagacatgcatgttacagaatgaccatgacccatcaaagttattagctgag
acaccatgcaaacttcttcgtttcttggttgctgatggtgctcatgttgatgctgatgta
ccatatgcggaagttgaggttatgaagatgtgcatgcccctcttatcacccgcttctggt
gtcatacatgttgtaatgtctgagggccaagcaatgcaggctggtgatcttatagctagg
ctggatcttgatgacccttctgctgttaagagagctgagccgttcgaagatacttttcca
caaatgggtctccctattgctgcttctggccaagttcacaaattatgtgctgcaagtctg
aatgcttgtcgaatgatccttgcggggtatgagcatgatattgacaaggttgtgccagag
ttggtatactgcctagacactccggagcttcctttcctgcagtgggaggagcttatgtct
gttttagcaactagacttccaagaaatcttaaaagtgagttggagggcaaatatgaggaa
tacaaagtaaaatttgactctgggataatcaatgatttccctgccaatatgctacgagtg
ataattgaggaaaatcttgcatgtggttctgagaaggagaaggctacaaatgagaggctt
gttgagcctcttatgagcctactgaagtcatatgagggtgggagagaaagtcatgctcac
tttgttgtcaagtccctttttgaggagtatctctatgttgaagaattgttcagtgatgga
attcagtctgatgtgattgagcgtctgcgccttcaacatagtaaagacctacagaaggtc
gtagacattgtgttgtcccaccagagtgttagaaataaaactaagctgatactaaaactc
atggagagtctggtctatccaaatcctgctgcctacagggatcaattgattcgcttttct
tcccttaatcacaaagcgtattacaagttggcacttaaagctagtgaacttcttgaacaa
acaaaacttagtgagctccgtgcaagaatagcaaggagcctttcagagctggagatgttt
actgaggaaagcaagggtctctccatgcataagcgagaaattgccattaaggagagcatg
gaagatttagtcactgctccactgccagttgaagatgcgctcatttctttatttgattgt
agtgatacaactgttcaacagagagtgattgagacttatatagctcgattataccagcct
catcttgtaaaggacagtatcaaaatgaaatggatagaatcgggtgttattgctttatgg
gaatttcctgaagggcattttgatgcaagaaatggaggagcggttcttggtgacaaaaga
tggggtgccatggtcattgtcaagtctcttgaatcactttcaatggccattagatttgca
ctaaaggagacatcacactacactagctctgagggcaatatgatgcatattgctttgttg
ggtgctgataataagatgcatataattcaagaaagtggtgatgatgctgacagaatagcc
aaacttcccttgatactaaaggataatgtaaccgatctgcatgcctctggtgtgaaaaca
ataagtttcattgttcaaagagatgaagcacggatgacaatgcgtcgtaccttcctttgg
tctgatgaaaagctttcttatgaggaagagccaattctccggcatgtggaacctcctctt
tctgcacttcttgagttggacaagttgaaagtgaaaggatacaatgaaatgaagtatacc
ccatcacgggatcgtcaatggcatatctacacacttagaaatactgaaaaccccaaaatg
ttgcaccgggtatttttccgaacccttgtcaggcaacccagtgtatccaacaagttttct
tcgggccagattggtgacatggaagttgggagtgctgaagaacctctgtcatttacatca
accagcatattaagatctttgatgactgctatagaggaattggagcttcacgcaattaga
actggccattcacacatgtatttgcatgtattgaaagaacaaaagcttcttgatcttgtt
ccagtttcagggaatacagttttggatgttggtcaagatgaagctactgcatattcactt
ttaaaagaaatggctatgaagatacatgaacttgttggtgcaagaatgcaccatctttct
gtatgccaatgggaagtgaaacttaagttggactgcgatggtcctgccagtggtacctgg
aggattgtaacaaccaatgttactagtcacacttgcactgtggatatctaccgtgagatg
gaagataaagaatcacggaagttagtataccatcccgccactccggcggctggtcctctg
catggtgtggcactgaataatccatatcagcctttgagtgtcattgatctcaaacgctgt
tctgctaggaataatagaactacatactgctatgattttccactggcatttgaaactgca
gtgaggaagtcatggtcctctagtacctctggtgcttctaaaggtgttgaaaatgcccaa
tgttatgttaaagctacagagttggtatttgcggacaaacatgggtcatggggcactcct
ttagttcaaatggaccggcctgctgggctcaatgacattggtatggtagcttggaccttg
aagatgtccactcctgaatttcctagtggtagggagattattgttgttgcaaatgatatt
acgttcagagctggatcatttggcccaagggaagatgcattttttgaagctgttaccaac
ctagcctgtgagaagaaacttcctcttatttatttggcagcaaattctggtgctcgaatt
ggcatagcagatgaagtgaaatcttgcttccgtgttgggtggtctgatgatggcagccct
gaacgtgggtttcagtacatttatctaagcgaagaagactatgctcgtattggcacttct
gtcatagcacataagatgcagctagacagtggtgaaattaggtgggttattgattctgtt
gtgggcaaggaagatggacttggtgtggagaatatacatggaagtgctgctattgccagt
gcttattctagggcatataaggagacatttacacttacatttgtgactggaagaactgtt
ggaataggagcttatcttgctcgacttggcatccggtgcatacagcgtcttgaccagcct
attattcttacaggctattctgcactgaacaagcttcttgggcgggaagtgtacagctcc
cacatgcagttgggtggtcccaaaatcatggcaactaatggtgttgtccatcttactgtt
tcagatgaccttgaaggcgtttctaatatattgaggtggctcagttatgttcctgcctac
attggtggaccacttccagtaacaacaccgttggacccaccggacagacctgttgcatac
attcctgagaactcgtgtgatcctcgagcggctatccgtggtgttgatgacagccaaggg
aaatggttaggtggtatgtttgataaagacagctttgtggaaacatttgaaggttgggct
aagacagtggttactggcagagcaaagcttggtggaattccagtgggtgtgatagctgtg
gagactcagaccatgatgcaaactatccctgctgaccctggtcagcttgattcccgtgag
caatctgttcctcgtgctggacaagtgtggtttccagattctgcaaccaagactgcgcag
gcattgctggacttcaaccgtgaaggattacctctgttcatcctcgctaactggagaggc
ttctctggtggacaaagagatctttttgaaggaattcttcaggctggctcgactattgtt
gagaaccttaggacatacaatcagcctgcctttgtctacattcccatggctgcagagcta
cgaggaggggcttgggttgtggttgatagcaagataaacccagaccgcattgagtgctat
gctgagaggactgcaaaaggcaatgttctggaaccgcaagggttaattgagatcaagttc
aggtcagaggaactccaggattgcatgagtcggcttgacccaacattaattgatctgaaa
gcaaaactcgaagtagcaaataaaaatggaagtgctgacacaaaatcgcttcaagaaaat
atagaagctcgaacaaaacagttgatgcctctatatactcagattgcgatacggtttgct
gaattgcatgatacatccctcagaatggctgcgaaaggtgtgattaagaaagttgtggac
tgggaagaatcacgatctttcttctataagagattacggaggaggatctctgaggatgtt
cttgcaaaagaaattagagctgtagcaggtgagcagttttcccaccaaccagcaatcgag
ctgatcaagaaatggtattcagcttcacatgcagctgaatgggatgatgacgatgctttt
gttgcttggatggataaccctgaaaactacaaggattatattcaatatcttaaggctcaa
agagtatcccaatccctctcaagtctttcagattccagctcagatttgcaagccctgcca
cagggtctttccatgttactagataagatggatccctctagaagagctcaacttgttgaa
gaaatcaggaaggtccttggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348450
Entry
4348450           CDS       T01015                                 
Name
(RefSeq) acetyl-CoA carboxylase 1
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00620  Pyruvate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4348450
   00640 Propanoate metabolism
    4348450
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4348450
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    4348450
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     4348450
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     4348450
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     4348450
SSDB
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Biotin_lipoyl ATP-grasp Dala_Dala_lig_C PCC_BT DUF6187
Other DBs
NCBI-GeneID: 4348450
NCBI-ProteinID: XP_015614129
UniProt: Q8S6N5
LinkDB
Position
10:11272733..11284989
AA seq 2267 aa
MEGSYQMNGILNGMSNSRHPSSPSEVDEFCKALGGDSPIHSVLVANNGMAAVKFMRSIRT
WALETFGTEKAILLVAMATPEDLKINAEHIRIADQFVEVPGGTNNNNYANVQLIVEIAER
THVSAVWPGWGHASENPELPDALKEKGIIFLGPPSAAMAALGDKIGSSLIAQAAGVPTLP
WSGSHVKIPPESCNSIPEEMYRSACVSTTEEAVASCQVVGYPAMIKASWGGGGKGIRKVH
NDDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKHGNVAALHSRDCSVQRRHQ
KIIEEGPITVAPSETVKELEQAARRLAKCVHYVGAATVEYLYSMETGEYYFLELNPRLQV
EHPVTEWIAEINLPAAQVVVGMGVPLYNIPEIRRFYGMEHGGGYDAWRKISAVATKFDLD
NAQSVKPKGHCVAVRVTSEDPDDGFKPTSGRVEELNFKSKPNVWAYFSVKSGGAIHEFSD
SQFGHVFAFGESRSLAIANMVLGLKEIQIRGEIRTNVDYTVDLLNAAEYRENKIHTGWLD
SRIAMRVRAERPPWYLSVVGGALYEASSRSSSVVTDYVGYLSKGQIPPKHISLVNLTVTL
NIEGSKYTIETVRRGPRSYTLRMNGSEIEAEIHSLRDGGLLMQLDGNSHVIYAETEAAGT
RLLINGRTCLLQKEHDPSKLLADTPCKLLRFLVADGSHVDADTPYAEVEVMKMCMPLLLP
ASGVIHFVMPEGQAMQAADLIARLDLDDPSSVRRAEPFHGTFPKLGPPTAVSGKVHQKFA
ASVNSAHMILAGYEHNINEVVQDLLNCLDSPELPFLQWQELMSVLATRLPKDLRNELDGK
YKEYELNSDFRKNKDFPAKLLRGIIEANLAYCSEKDRVTNERLVEPLMSLVKSYEGGRES
HARVVVKSLFEEYLSVEELFSDNIQSDVIERLRLQHAKDLEKVVYIVFSHQGVRTKNKLI
LRLMEALVYPNPSAYRDQLIRFSGLNNTVYSELALKASQLLEHTKLSELRTSIARSLSEL
EMFTEEGERVSTPRRKMAINERMEDLVGAPLAVEDALVALFDHSDPTLQRRVVETYIRRL
YQPYLVKGSVRMQWHRSGLIALWEFSEEHIKQRNGQDAMSLKQQVEDPEEKRWGVMVVIK
SLQYLSSAIDAALKETSHYKAGAGNVSNGNSASSSHGNMLHIALVGINNQMSTLQDSGDE
DQAQERINKISKILKDSTVTSHLNGAGVRVVSCIIQRDEGRPPMRHSFQWSVDKIYYEED
PMLRHVEPPLSTFLELNKVNLDGYNEVKYTPSRDRQWHIYTLIKNKKDQRSNDQRLFLRT
IVRQPGVTNGFLSGNVDNEVGRAQASSSYTSSSILRSLMAALEEIELHAHNETVRSSYSH
MYLCILRVQQLFDLIPFSRTIDNVGQDEATACTLLKNMALNIYEHVGVRMHRLSVCQWEV
KLWLDCDGQASGAWRVVVTNVTGHTCTVDIYREVEDSNTHKLFYHSVTPSLGPLHGIVLD
EPYKPLDAIDLKRYSARKNETTYCYDFPLAFETALKRSWKSTLSVVAEANEHNKSYAKVT
ELMFADSTGSWGTPLVPVERSPGINDIGIVAWIMKLSTPEFPSGREIIVVSNDVTFKAGS
FGPREDAFFDAVTNLACERKLPLIYLSATAGARLGVAEEIKACFNVGWSDDESPERGFHY
IYLTEQDYSRLSSSVIAHELKLESGETRWVVDTIVGKEDGLGCENLHGSGAIASAYSKAY
KETFTLTFVTGRAVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGG
PKIMATNGVVHLTVSDDLEGVSAILKWLSYVPPYVGGPLPIMKPLDPPDRPVTYFPENSC
DARAAICGVQDSQGKWMGGMFDRESFVETLEGWAKTVVTGRAKLGGIPVGVIAVETQTMM
QVIPADPGQLDSAERVVPQAGQVWFPDSATKTAQALLDFNREELPLFILANWRGFSGGQR
DLFEGILQAGSNIVENLRTYNQPAFVYIPMGGELRGGAWVVVDSKINPEHIEMYAERTAK
GNVLEPEGLVEIKFRPKELEECMLRLDPELIKLSTRLREMKKENAGLSEMDTTRRSIIAR
MKQLMPIYTQVATRFAELHDTSARMAAKGVIGKVVDWEESRSFFYRRLRRRVTEDALAKE
IREAAGEQLSQKSALDYIKKWYLSSNGSDGNSEKWNNDEAFFAWKDDPTNYENQLEELKA
ERVSKWLSRLAESPDVKALPNGLSIVLNKMNPSKREQVIDGLRQLLG
NT seq 6804 nt   +upstreamnt  +downstreamnt
atggagggatcttaccaaatgaatggcatactgaacgggatgtctaattcgaggcatccg
tcgtcaccctctgaggtcgatgagttctgcaaagcgctcggtggtgattcaccgatacac
agtgtgctggttgccaacaatggcatggccgctgtcaagttcatgcgcagcatccgtaca
tgggcgctggagacctttgggacggagaaggcgattcttttggtcgccatggcaactccc
gaggacttgaagataaacgcggagcacataaggatcgccgaccaattcgtagaagttcct
ggtggtacaaataataacaattatgcgaatgtacagctcatagtggagatagcagagaga
acacatgtttctgcagtttggcctggctggggtcatgcatctgagaatcctgaacttccg
gacgcactgaaggagaaaggaataatttttcttgggccaccatcagccgcgatggcagcg
ctaggtgataagattggttcatctcttattgcacaagcagcaggagttccaactcttcca
tggagtggatcacatgtgaaaattccaccagaaagctgcaattcgatacctgaggagatg
tacaggagtgcctgtgtctccactacagaggaagcagtagctagttgtcaggtggtggga
tatcctgctatgatcaaggcatcatggggtggtggtggtaaaggaataaggaaggtacat
aatgatgatgaggtgagagcactgtttaagcaagttcagggagaagtccctggctcacct
atatttattatgaaggtggcatctcagagccgacatctagaggttcagttgctctgtgac
aaacatggcaatgtggcagctctgcacagtcgagactgtagtgttcaaagaaggcaccaa
aagattattgaggaggggccaattacagttgctccttcagagacagttaaagagcttgag
caagcagcaaggcggcttgctaaatgtgtgcattatgtgggtgctgctacagtagaatat
ttgtacagcatggaaacaggagaatactattttctggagcttaatccacggttgcaagta
gaacaccctgttaccgaatggatagctgaaataaacttgcctgcagctcaagttgttgta
ggaatgggtgtgccgctctacaatattcctgagatcagacgcttttatggaatggagcat
ggtggtggttacgatgcgtggaggaaaatatcagctgttgcaactaagtttgatttggat
aatgcacagtctgtaaagccaaagggtcactgtgtagcagtcagagttaccagtgaggat
ccagatgatggatttaagcctactagtggaagagttgaggagctaaactttaaaagcaaa
ccaaatgtttgggcctatttctccgttaagtctgggggagcaattcatgaattttcagat
tctcaatttggacatgtgtttgcattcggggaatctagatcgttggcaatagcaaatatg
gtgcttgggttaaaagagatccaaatccgtggagagatacgcactaatgttgattacaca
gtggatctcttgaatgctgcagaatatcgggaaaataagatccacactggttggctagac
agcagaattgctatgcgtgttagagctgagaggcccccatggtacctttcagttgttgga
ggagctctatatgaagcatcaagcaggagctcaagcgttgttacagattatgttggttat
ctcagcaaaggtcaaataccaccaaagcacatctctcttgttaatttgactgttacccta
aatattgagggaagcaaatacacgattgagacagtaagacgtgggccccgtagctacaca
ttaagaatgaatgggtcagagattgaagcagagatacactcgttgcgagatggaggactc
ttgatgcaattggatggaaacagtcatgtaatttatgcggagacagaagctgctggtaca
cgccttctcatcaatgggagaacatgcttattacagaaagagcatgatccttccaaattg
ttggctgatacaccttgcaaacttcttcggttcttggttgcggatggctctcatgtagat
gctgatacaccatatgctgaggttgaggtcatgaagatgtgtatgccgctgttactacca
gcttctggtgttattcattttgtcatgcctgagggtcaagccatgcaggcggctgacctg
atagcaaggttggaccttgatgacccctcttctgtgaggagagctgaaccattccatggc
acctttccaaaactgggacctccaactgctgtttctggaaaagttcaccaaaagtttgct
gcaagtgtcaattccgcacacatgatccttgcaggatatgaacataatatcaatgaagtt
gtacaagatttgttaaactgcttagatagccctgagcttccttttctacagtggcaagaa
cttatgtctgttttggcaactcggcttccgaaagatctcaggaatgagttggatggcaag
tacaaggagtatgagttgaactctgattttcggaagaacaaggattttcctgccaagtta
ctaaggggaattatagaggcaaatcttgcatactgttctgaaaaagatagagttactaat
gagaggcttgttgagccacttatgagcctggtcaaatcatacgagggtgggagagaaagc
cacgctcgtgttgttgtcaagtctctatttgaggagtacctgtctgttgaggaactcttc
agtgacaatattcagtctgatgtgatagaacgtctacgacttcaacatgccaaagacctc
gagaaggtcgtatacattgttttctcccaccagggtgtgcggaccaaaaataaactcata
ctacggcttatggaagcattagtctatccaaatccatctgcttacagagaccagttgatt
cgtttctctgggctgaacaacacagtgtactctgagttggcacttaaagcaagccagctt
cttgagcatactaaattgagtgaactccgcacaagcatagcaagaagcctctcagagctg
gagatgtttactgaagaaggagagcgggtgtcaacacccaggagaaagatggccattaat
gagaggatggaagatttagtgggtgccccacttgcagttgaagatgcccttgtggctttg
tttgatcacagtgatcctacacttcagcggagagtggtcgagacatacatacgtagattg
tatcagccttatctggtcaagggcagtgttcggatgcagtggcatagatctggtctaatt
gctttatgggaattctcggaagagcatattaagcaaagaaatggacaagatgcgatgtct
ctaaagcagcaagttgaggaccccgaagagaaaagatggggtgtcatggttgtaatcaag
tctctccagtatttatctagtgctattgatgctgcattgaaggagacttcacactacaaa
gcaggtgctggaaatgtctcgaatggcaattctgcaagttccagccatggcaatatgctg
catattgctttggttggtatcaacaatcagatgagcactcttcaagacagtggtgatgag
gaccaggctcaagaaaggatcaacaaaatttcaaaaattttgaaggatagtactgtaaca
tcacatctcaatggtgctggcgttagggtagtcagctgcattatccaaagggatgaaggg
cgcccaccgatgcgtcactccttccaatggtcagttgataagatatattatgaagaggat
ccgatgctccgccatgttgaacctcctctatctacattccttgagttgaacaaggtgaat
ttggatggttacaatgaagtaaagtacactccatcacgcgatcgccagtggcatatttac
acactcatcaagaacaagaaagatcagagatcaaatgaccagaggttgttccttcgtacc
atagtaaggcaaccaggtgtgaccaatgggtttttgtcaggaaatgttgacaatgaagta
ggccgtgctcaggcttcatcatcatacacatcaagtagtatactcagatcactgatggca
gcactagaagaaatagagctacatgcacataatgagacagtgaggtcaagctattcacac
atgtatctgtgcatattgagagtacaacagttgtttgatcttataccattttcaagaacg
attgataatgttggtcaagatgaagcaactgcatgtacgcttttgaagaatatggctttg
aatatatatgaacatgttggggtgaggatgcatcgcctttctgtgtgtcagtgggaagtg
aagttatggttggattgtgatggacaagcaagcggtgcttggagagtagttgttaccaat
gtaactggccacacctgcactgtcgatatttaccgagaagtggaggattctaatacacat
aaacttttctaccactctgttacaccatcactgggtcctttgcatggcattgtgttggat
gaaccatacaagccattggatgctattgacctcaaacgttactctgctaggaagaacgaa
actacgtactgctatgacttcccgctggcttttgaaacagcactgaagaggtcatggaaa
tcaaccctctctgttgttgctgaagctaatgagcataataagagctatgctaaagtgaca
gagcttatgtttgctgattcaactggatcatggggtactcctttggttccagttgagcgt
tctccaggtatcaatgatattggcattgtcgcttggatcatgaagctctccacaccagaa
tttccaagtggccgggagattattgttgtttcaaatgatgtgacatttaaagctggatca
tttggtcctagggaagatgctttctttgatgcggtcaccaatcttgcttgtgagaggaaa
cttcctcttatctacttgtcagcaactgctggtgctaggctcggtgtagctgaggaaata
aaagcatgcttcaatgttggttggtctgatgacgagagccctgaacgtggttttcattac
atttacctcactgaacaagattattcgcgcctgagttcttcggttatagcccatgaactg
aaactagaaagtggagaaactagatgggttgttgataccattgttggaaaagaggatgga
ctcggttgtgagaacttgcatggaagtggtgccattgccagtgcctattctaaagcatac
aaggagacctttactctgacattcgtaactggacgagctgttggaattggtgcttatctt
gctcggttaggcatgaggtgtatacagcgtcttgatcagccaattattttgacaggattt
tctgcgctgaataagcttctggggcgggaggtatacagctctcacatgcaactaggtggc
cccaaaatcatggctacaaatggtgtcgtccatctgactgtgtcagatgaccttgaaggt
gtttctgcaatcttgaaatggctcagctatgttcctccttatgttggtggtcctcttcct
atcatgaagcctcttgacccaccggatagacctgtaacatacttccctgagaattcatgt
gatgctcgtgcagctatctgcggtgtgcaggacagtcaaggcaagtggatgggtggtatg
tttgacagagaaagcttcgtggagacattagaaggctgggcaaaaactgttgtcaccgga
agagcaaagcttggtggaattccagttggtgtcatagctgtggaaacccagactatgatg
caagtcatccctgctgatccaggtcagcttgattctgccgagcgtgtggttcctcaagca
gggcaggtgtggtttcctgattctgccaccaaaacagcccaggcattgctggatttcaac
cgtgaagagcttccgctgttcatcctcgctaactggagaggcttttctggtgggcaaagg
gatctgtttgaaggaatccttcaggctggttctaatattgttgagaatctgaggacatat
aaccagcctgcttttgtgtatattccaatgggcggagagcttaggggaggtgcatgggtt
gtggtagatagcaaaatcaatccagaacacattgagatgtatgctgagagaactgcaaaa
ggtaatgtccttgaaccagaaggattggttgagatcaaattcaggccaaaggaactggaa
gaatgcatgctaaggcttgacccggagttgatcaagctgagtacaaggctgagagaaatg
aagaaggaaaatgctggcctctcggaaatggacaccactaggaggagtattattgctcgg
atgaagcaactgatgcctatatatacccaggttgctacacggtttgctgaattgcatgac
acctctgctagaatggctgccaaaggtgtgatcggaaaggttgtcgattgggaagaatct
cggtcctttttctataggaggttgcgaaggagagttactgaagatgcacttgccaaggaa
atcagagaagctgctggcgagcagctgtcccagaaatctgcattggactatatcaagaaa
tggtacctttcttccaatggatctgatggaaacagtgaaaagtggaataacgatgaagct
ttctttgcttggaaagatgatccaacaaactatgagaatcaactcgaggagttgaaggct
gaaagagtatccaagtggctctcgcgtctcgctgaaagccctgatgtgaaagctttgcca
aatggtctttcaattgttcttaacaagatgaatccttcaaagagggagcaggttattgat
ggtctcaggcagcttctgggttga

DBGET integrated database retrieval system