KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338489
Entry
4338489           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 7
  KO
K03132  transcription initiation factor TFIID subunit 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4338489
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4338489
   03036 Chromosome and associated proteins [BR:osa03036]
    4338489
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4338489
   Coactivators
    SAGA/TFTC/STAGA complex
     4338489
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     4338489
SSDB
Motif
Pfam: TAFII55_N
Other DBs
NCBI-GeneID: 4338489
NCBI-ProteinID: XP_015637757
UniProt: Q5W6Q8 B9FP16
LinkDB
Position
5:complement(16343844..16346627)
AA seq 200 aa
MEEQFILRVPPSVAERIERLMNESAAASSSSNPEDASLDLSFSEDGRNGTFMIGNESFPA
SLLDLPTVVESYKTYDDSVLIKTADIGQMIMVREEEDPAPEGVEYKHGLTPPMRDARRRR
FRREPDLNAELVHRVEKDLISIMHGVSINQNASAILRAGEGGDRKKAGPAPATKPNVKQP
AANGEEAEAERSDSDESVDP
NT seq 603 nt   +upstreamnt  +downstreamnt
atggaggagcagttcatcctccgggttcccccctccgtcgcggagcggatcgagcgcctc
atgaacgaatccgccgccgcctcctcctcttccaaccccgaagacgcgtccctcgacctc
tccttctcagaggatggaagaaatggcacatttatgattgggaatgaaagctttcctgca
tcactcttggatctcccaactgttgtggagtcatacaagacatatgatgattcagtgcta
attaaaacagctgatattggtcagatgattatggtaagagaagaagaagatcctgctcca
gaaggagttgaatacaagcatggtcttactcctccaatgagggacgcacgcaggcggcgt
ttccgcagggagcctgatttgaatgccgaacttgttcaccgagttgagaaggatctcatt
agtattatgcatggggtatctatcaaccagaatgccagtgcaattctaagggcaggagaa
ggtggcgatcgtaagaaagcgggaccagctccagcaaccaaacctaatgtcaaacaacct
gctgcaaatggcgaagaagctgaggcagagaggagtgactctgatgagtccgttgacccg
tag

DBGET integrated database retrieval system