KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338511
Entry
4338511           CDS       T01015                                 
Name
(RefSeq) anaphase-promoting complex subunit 1 isoform X1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4338511
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4338511
   03036 Chromosome and associated proteins [BR:osa03036]
    4338511
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     4338511
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    4338511
SSDB
Motif
Pfam: ANAPC1 APC1_C Apc1_MidN PC_rep Apc1_N
Other DBs
NCBI-GeneID: 4338511
NCBI-ProteinID: XP_015640103
LinkDB
Position
5:16752442..16774654
AA seq 1817 aa
MAPAIGSRRLTVLREFRPHGLAAEEADGEGGPGERPPQDYDYFLFDPALAASPAPEPGEE
AASSSSGADGDHELFIRGNRIIWSAGSRVHKRYLSPNTVIMACWCRMDKTRDALLCVLQV
DTLSIYNVNGEVASIPLPYAVSSIWPLPSGLLLQKSTDGGHMVLSSTSLLKSRDLIRPNK
EFGLNYNVSSQVNTLETVSKADGAIFSSHLILKHPLEEPQATYFEEWGRLDMMKDFDEKT
IWTSDIVPLMASYHKGKFQHSVWQIDGTTYQEEINDNAVPPIPCDISMHKFAFRKIWQGK
CSQSAASKVFLATDIDGTPIICFLLHEQKILLAVRFQVDENNGESFGDIKPHMSWNIPAL
AAAPVVVTRPRAWAGVLPFTDILILTPDNDLLLYSGKQCLCRYTLPTELGKGIFSNYELN
SGVTEFYSDMEITSITDAVEGRINVTCSNGLMLRCSLRKSPSSSLVGDCITAMAEGLQSC
FYSHFVSLLWGDSDAAYLCSSSHVDSEWESFSYEVEKICAKYGQISPAKSSESPCTAWDF
LINSKHHAKYGKQSRTSLPMSYNTSSMSFHSFPQDGNSADVSFYIRFISETLDTLHALYE
NLKLNILRKQDLASLASLLCRVASSLGENSYVDYYCRDFPDNLVEFHSLSSATALRAPPC
LFRWLENCLRHGCDLKTSDDIPALMCKEKSSAVSWGRKVVSFYSLLLGAERIGKNLSSGV
YCEVASGSARNTEELTVLTMVAEKFGRQQLDLLPIGVSLVLRHALDKCRESPPDDWPAPA
YVLVGRDDLAMARMGSGRRENGFWNNDNLTSISVPYMLHLQPVTVLTTALDVPPSEILNS
EDTDSVYRSVEDGMEHIFTSTTQLRYGRDLRLNEVRRLLCSARPVAIQTPNNPSVSDQDL
QQQQLWNFAQRTTALPFGRGAFTLATTYTLLTEALVFPKLVLAGRLPAQQNATVNLDLST
RSVSEFKSWAEFHNGVAAGLRLAPFQEKMLRTWIQYNRPSEPNFTHAGLLLAFGLHEHLR
VLTMTDAYRYLSQEHDITRLGLLLGLAASNRGTMHPAISKMLYFHVPSRHPSSTPELELP
TLLQSAAVMGIGLLYEGSAHALTMKILLGEIGRRSGGDNVLEREGYAVAAGSALGLVALG
RGSNAFGFMDTFLDRLFEYIGSKEVYHEKHLNAAIAADEQSGNTGQMMEGAQINVDVTAP
GAIIALALIFLKAESEEIAARLSVPNSHFDLQYVRPDFVMLRIVARNLILWNRIQPTKDW
VESQVPSFVNFGVSNTSQEAMDSDELDSEALFQAYVNIVTGACIALGLKYAGSRNSDAQE
LLYAYAVHFLNEIKHISIQTASILPKGLLQHVDRGTLELCLHLIVLSLSLVMAGSGHLQT
FRLLRYLRGRSSAEGQVNYGLQMAVSLAIGFLFLGGGTHTFSTSNSAVAALLITLYPRLP
TGPNDNRCHLQAFRHLYVIATEPRWIQTVDVDTGLPVYCPLEVTVAETEYYDETNYCEVT
PCLLPERSVLKNIRVCGPRYWSQVITLTPEDKPWWKSGDRTDPFNGGVLYIKRKVGSCSY
SDDPIGCQSLLSRAMHEVCDTPSTSCSNQANSATRSSLRVDQLVSTFSANPSLIAFAKLC
CQSWKDRRNGSFEEFCSQILYECMSKDRPALLQVYISFYTIIETMWEHLKIGHFPFSDSL
FLSSLKVASAYNEALIDGRITTGGIIQSTFLESLMKRIEYIFAELPNLHDSFINYLNKGK
WPDAQNEAVLLSWYLQWYSIPPPHIVSSAIEKVKPRTRTSLSMLPLLRLLLPTTHLVGLM
EIEKLHMTHGHEGLTLH
NT seq 5454 nt   +upstreamnt  +downstreamnt
atggctccggcgatcgggtcgcggcggctcacggtgctgcgggagttccgcccgcacggg
ctcgcggccgaggaggccgacggcgagggcggccccggggagcggccgccgcaggactac
gactacttcctcttcgacccggccctcgccgcctccccggccccggagcccggggaggag
gccgcctcctcctcctccggcgccgacggcgaccacgagctcttcatccgtgggaatcgg
ataatatggagtgccggctcacgtgtccacaaaagatacctctcaccaaatacagtcata
atggcctgctggtgtaggatggacaaaactcgtgacgcacttctatgtgttctgcaggtc
gatactttatctatatacaatgtaaatggcgaggttgccagtattccactaccatatgct
gtttcatcaatatggcctcttccttctggccttctacttcagaaatctactgatggaggc
catatggtattatcctcaacttcactgctaaaatcgagggatttaattcgtcctaacaag
gaatttggattgaattacaatgtttcatcccaagtcaatactttggagactgtcagtaaa
gctgatggggctattttttcgtctcacctcatcttgaaacatccacttgaagagcctcag
gcaacatattttgaagaatggggcaggttggatatgatgaaagattttgatgaaaaaact
atatggacaagtgatatagtacctctaatggcatcatatcacaaaggaaaatttcagcac
tctgtttggcaaattgatggtacaacttaccaggaagaaatcaatgacaatgcagtgccc
ccaattccatgtgatatttctatgcataagtttgcattccgtaagatatggcaggggaaa
tgctcccaatctgctgctagtaaggttttcttggcaactgacatcgatggtacaccaata
atttgttttttacttcatgagcaaaaaatattgcttgctgtgagatttcaagttgacgag
aataatggagaatcctttggagatattaaacctcacatgagctggaacattcctgcatta
gctgctgcaccagttgtcgtaactcgcccaagagcatgggctggagtccttccctttacg
gacatcctcattctaactcctgacaatgatctacttctttattctggaaagcagtgcctc
tgcagatatactcttcctactgaattggggaagggtatattttcaaattatgagctaaat
tctggggttacagagttttactctgatatggagatcacaagcataacggatgctgttgaa
ggtcgtataaatgtgacatgcagcaatggtctgatgctccgatgttcattacgcaagagc
ccttcctcttctctggttggtgactgcataaccgcaatggcagagggcttgcagagctgc
ttttacagtcattttgtttctcttctctggggtgatagtgatgctgcttacctttgttcg
agctctcatgtggattcagaatgggaatcatttagttatgaagtagaaaagatttgtgca
aaatatggacagatttcaccagctaaatcatccgaatcgccttgcacagcttgggacttt
ctgatcaacagcaagcaccacgccaagtacggcaaacaatcccgaacctctttgcctatg
tcatataatacaagcagcatgagtttccactctttcccccaagacggaaatagtgcagat
gtttcattttatattcggtttataagtgaaactttggacacattgcatgccctatatgag
aacctgaagctgaatattttgaggaaacaggatctagctagtcttgcttccttgttatgt
agagttgcttcgtcccttggtgaaaacagttatgtagattactattgccgagactttcct
gacaacttggttgaattccattccctatcatctgctactgccttaagagctccaccatgc
ttatttcgttggcttgaaaactgtctccgtcatggctgtgatttgaagacttcagatgat
attcctgctctaatgtgcaaggaaaaaagttctgctgtgagctggggcagaaaagtggtg
tcattttatagtttgttattaggagcagaaaggattggaaaaaatctctcttctggtgtc
tactgtgaagtagccagtggttcagccagaaacaccgaggaacttactgttctcactatg
gttgctgagaagtttgggcgccaacaattggatttattaccaattggagtatctcttgtg
cttcgccatgcactggacaaatgccgtgagtctcctccagatgactggcctgcacctgct
tatgttcttgttgggagggatgatctagctatggcaaggatggggtcaggaaggagagaa
aatgggttttggaacaatgataatctgacatcaatatcagtcccatatatgctacatttg
caacctgtaactgtactgacgactgcattggatgtccctccatcagaaattttgaattcc
gaggatactgattctgtttacagatctgtagaagatggaatggaacacatcttcacctca
acaacacaactgcgatatggtcgtgatttacgtctgaatgaggttagacgcctcttatgc
tcagcaagacctgtggcaatacagacacccaataatcctagtgtgtctgatcaggatcta
caacagcaacaactatggaactttgcacaaagaacaacagctttaccttttgggcgtggg
gcttttactttagctacaacttacacactgttaacagaggctctggttttcccaaagctt
gttttggctggtcggttgcctgcacaacagaatgcaacagttaatcttgacctaagtact
agaagcgtctcagaattcaaatcttgggctgagtttcacaatggtgtcgctgctgggctc
aggcttgctccttttcaggagaaaatgttaagaacctggatacaatataatagaccttct
gaaccaaattttactcatgctggtctgcttcttgcatttggtttgcatgaacatctacga
gttttaactatgaccgacgcttaccgatatctctcccaggagcatgatataactagactt
ggtttgctacttggtttggctgcatctaatagggggacaatgcacccggcaatttcaaag
atgctctattttcatgtcccttcccggcatccatcttctacgccagagttggaattacct
actcttctgcagtcagcagcagtgatgggaattggacttctctatgaagggtcagcacat
gcattaaccatgaaaattcttctgggtgagattggccgaagaagtggtggtgataatgtg
ctagaaagagaaggctatgctgttgctgcaggctctgcattaggacttgttgcattaggt
cgtggaagcaatgctttcggattcatggacactttcctggaccggctttttgaatacatt
ggcagtaaagaagtctaccatgaaaaacacttaaatgcagcaatagctgctgatgagcaa
agtggcaacaccggacagatgatggaaggagcacaaataaatgttgatgttactgcacct
ggagcaataattgctctagccttgatatttctgaaagcagagtcagaagaaattgcagct
agactcagtgttcccaatagtcactttgatctgcagtatgtgagacctgattttgtaatg
cttcgcattgtagcacggaatttaatattgtggaacagaatacaacctaccaaagattgg
gttgagtctcaagttccttcatttgtcaactttggtgtttccaatacgagtcaagaggct
atggacagtgatgaattggatagcgaagctctgtttcaagcttatgttaatattgtcact
ggagcatgcattgcacttggtctcaaatatgctggcagtagaaatagtgatgcccaagaa
ctactctacgcttatgccgtccattttctcaatgagatcaaacacatatctattcagact
gcaagcatattgccaaagggattgttgcagcatgttgatcgtggaactcttgagctctgc
ttgcatcttattgttctctctctatcactggtaatggcaggatctggacatttacaaact
ttccgcttactgcgttatctgaggggaagaagttctgcagaaggacaagtaaattatgga
ctgcagatggctgtaagcttggctataggattcttattccttggaggtggtacacacaca
ttctcaacttcaaatagtgcagttgccgcattactcatcaccctttacccacgtttgcct
actggaccaaatgataatcgctgtcatctccaggcattcaggcatctgtatgtaatagct
acagaacctcgatggattcagacagtagatgttgacacaggacttccggtgtattgtcct
cttgaagtgacagttgctgaaacggagtattatgacgagactaattactgtgaagtgaca
ccttgtcttctgccagagcgctcagtgctgaagaacattcgagtttgtggacccagatat
tggtctcaggtgattacacttacacctgaagataagccatggtggaaatctggagacagg
actgacccattcaatggtggagtactctatataaaacggaaagttggatcttgttcctac
tcagatgatccaattggatgccaatctttgctttctcgagcaatgcatgaggtttgtgat
acaccatccacgagctgcagtaatcaggcaaacagtgctactcgtagttcacttagagtc
gatcagttagtaagcacattttctgctaatccaagcttgatagcttttgcaaaactgtgt
tgtcagtcatggaaggacaggcgcaatggcagttttgaagagttctgctctcaaatactt
tatgaatgtatgagcaaggataggccagcactattgcaggtgtatataagtttttacaca
ataattgagacaatgtgggagcatctaaagattggacattttcctttctctgattctctt
ttcctttccagcttgaaggttgcatcagcctataatgaagcactgattgatggtagaatt
acaactggaggcattattcagtccacatttttggaatcacttatgaagcgcatagagtac
atcttcgcagaattgccgaacctgcatgacagcttcatcaattacctgaacaaaggcaaa
tggcctgatgcacaaaacgaagcagtgctcctttcttggtatctccagtggtacagcatc
ccacctccccatattgtgtcatccgcaattgaaaaggtgaagcccagaactcggaccagc
ttgtccatgctcccgcttcttcggctcctgctgccaaccacacatctcgtggggctcatg
gagattgagaagcttcacatgactcatggtcacgagggcttgaccttgcactga

DBGET integrated database retrieval system