KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338675
Entry
4338675           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1
  KO
K12813  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4338675
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4338675
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4338675
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    4338675
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    4338675
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 AAA_19 SRP54 DUF2075 T2SSE AAA_7
Other DBs
NCBI-GeneID: 4338675
NCBI-ProteinID: XP_015637331
UniProt: A0A0P0WLZ9 Q6I5X9
LinkDB
Position
5:complement(18872361..18875783)
AA seq 1070 aa
MAASDDGQLRTWVSDRLMALLGYSQGLVARLVVRLARECASAGDLAARLVDLAGFPPSPD
TAAFAEDVYGRVPRSCGGGGDDAGVSEYQRQMQEAAAMAKKQSTIKLLDDDGEIGVSASP
SSGGRKRFRRKAVGEDDDDAGRNARRRRSPDDEEEDGDAGEEEEMERDQIERAQLERNIR
ERDAASTRRLTDRKTTKREQGELARRSDAMDKNDTSGLRRLSRRAYLQRRKEKKVEEMRD
EIVDHEFLFPGVQLTAAEERDMRHKKQVYGLVHDRDDYYRMPDAYDAAANVDQEKRFSVA
RRRYEEPAEAARDGKTANALSEQEAWEEQQIRKSRLQFGSMDRGRRGDEYELLFDDGVEF
VRSTVMAGTAPADDDDTAAAAAADEYHAEAMDAKATLQDERKTLPVYKLKDDLLKAIDEH
KVLIVVGETGSGKTTQIPQYLHEVGYTAGGRKKVACTQPRRVAAMSVAARVAEEMGVKLG
HEVGYSIRFEDCTSEKTVIKYMTDGMLLREFLGEPDLGSYSVVVVDEAHERTLATDILFG
LVKDIARLRPDMKLLISSATLNADKFSDFFDAAPVFRIPGRRFEVGIHYTVAPEADYIDA
AVVTVLQLHVTEPPGGGDILLFLTGQEEIETVEEILRHRLRVLGGKVAELVICPIYANLP
AELQAKIFEPAPAGARKVVLATNIAETSLTIDGIKYVVDPGFCKVKSYNPRTGMESLLVA
PVSRASAEQRAGRSGRTGPGECFRLYTEYNFVSDLDDDAVPEIQRSNLASVVLALKALGI
NDLVGFDFMDPPPAESLLRALEELFALGALNSRGELTKTGRRMAEFPLDPMLSKAIVASE
RYGCSEEVITIAAMLSAGNAVFYRPRDKRVHADAARRAFHAGNAGDHVALLNVYNAWAES
GYSPQWCRESFVQHRTMRRARDVRDQLGALLERVEIAPCSSAGGGDLDAVRKAVTAGYFR
HAARLQRDGSYRAVKSRQTVFVHPSSGVAQAPPRWALYHELVLTTKEYMRQVTELKPEWL
VEIAPHYYERKDVDEPEPKKTAAATTPQEQTTAGSTPTKQTPNLNSFFDV
NT seq 3213 nt   +upstreamnt  +downstreamnt
atggcggcgagcgatgatggccagctcaggacgtgggtctccgaccgcctcatggcgctc
ctcggatactcccagggcctcgtggcgcggcttgtcgtccgcctcgcgcgggagtgcgcc
tccgcgggtgacctcgcggcgcggctcgtcgacctcgccgggttcccgccttcccccgac
accgccgcgttcgccgaggacgtgtacgggagggtgccccgcagttgcggcggcggcggc
gacgacgccggggtcagcgagtaccagaggcagatgcaggaggctgcggcgatggccaag
aagcagagcaccatcaagctgctcgacgacgacggcgagatcggcgtttccgcgtcgccc
tccagcggcggcaggaagcgtttcaggaggaaggccgtgggcgaagacgatgacgatgcc
ggacggaacgcgcgacggcggcgtagcccggacgacgaggaggaggacggcgacgccggc
gaggaagaagagatggagcgggatcagatcgagagggcgcagctcgagcggaacatcagg
gagcgcgacgcggcgagcacgaggaggctgacggatcggaagacgaccaagcgggagcag
ggcgagctcgcgcgccggtcggacgccatggacaagaacgacacctcggggctcaggagg
ctctcccggcgcgcgtacctgcagaggcggaaggagaagaaggtcgaggagatgcgcgac
gagatcgtcgaccacgagttcctcttccccggcgtccagctgacggccgccgaggagagg
gacatgaggcacaagaagcaagtctacggcctcgtgcacgatcgcgacgactactacaga
atgccggacgcctacgacgccgccgcgaacgtcgatcaggagaagaggttctcggtggcg
cggcggcggtacgaggagccagctgaggcggcgagggacggcaagacggcgaacgccttg
tccgagcaggaggcctgggaggagcagcagatacggaagtcgaggctgcagttcggatcc
atggatcgcggccggcgcggcgacgagtacgagctcctgttcgacgacggcgtcgagttc
gtcaggtcgacggtgatggcgggcaccgcgcctgcagacgacgacgacacggcggcggcg
gcggcggccgacgagtaccatgccgaggccatggatgccaaggccacgttgcaagacgag
aggaagactctcccggtgtacaagctcaaggacgacctgctcaaggccatcgacgagcac
aaggtcctgatcgtcgtcggcgagaccggctccggcaagacgacgcagataccgcagtac
ctccacgaggtcgggtacacggcgggggggaggaagaaggtggcgtgcacgcagccgcgg
cgcgtggcggcgatgagcgtggcggcgagggtggcggaggagatgggcgtcaagctcggg
cacgaggtcggctactccatccggttcgaggactgcacgtcggagaagacggtgatcaag
tacatgaccgacgggatgctcctccgcgagttcctcggcgagcccgacctgggcagctac
agcgtcgtcgtcgtcgacgaggcccacgagcggacgctcgccaccgacatcctcttcggc
ctcgtcaaggacatcgcccgcctccgccctgacatgaagctgctcatctccagcgcgacg
ctcaacgccgacaagttcagcgacttcttcgacgcggcgcccgtcttccggatccccggg
cggcggttcgaggtgggcatccactacaccgtggcgccggaggcggactacatcgacgcc
gccgtcgtgacggtgctgcagctgcacgtcacggagccccccggcggcggcgacatcctg
ctgttcctcacggggcaggaggagatcgagacggtggaggagatcctgaggcatcggctg
cgggtgctcggcggcaaggtggcggagctggtgatctgccccatctacgccaacctcccc
gccgagctgcaggccaagatcttcgagccggcgccggcgggcgcgcgcaaggtggtgctc
gccaccaacatcgccgagacgtcgctgaccatcgacgggatcaagtacgtggtcgacccg
gggttctgcaaggtgaagtcgtacaacccgcgcaccgggatggagtcgctgttggtggcg
ccggtgtcgagggcgtcggcggagcagcgcgccggccggtcggggcgcaccgggccgggc
gagtgcttccggctctacacggagtacaacttcgtcagcgacctcgacgacgacgcggtg
ccggagatccagcggagcaacctcgccagcgtcgtgctggcgctcaaggcgctcgggatc
aacgacctcgtcggcttcgacttcatggacccgccgccggcggagtcgctgctcagggcg
ctggaggagctcttcgccctcggcgcgctcaacagccgcggcgagctcaccaagaccggg
aggaggatggcggagttccccctggaccccatgctctccaaggccatcgtcgcgtcggag
aggtacgggtgctccgaggaggtgatcaccatcgcggccatgctgtccgccgggaacgcc
gtcttctaccgcccaagggacaagcgggtccacgccgacgccgcacggcgggcgttccac
gccggcaacgccggcgaccacgtcgcgctgctcaacgtgtacaacgcgtgggcggagtcc
ggctactcgccgcagtggtgccgcgagagcttcgtgcagcaccgcaccatgcggcgcgcg
cgggacgtgcgggaccagctgggggcgctgcttgagcgggtggagatcgcgccgtgctcc
tccgccggcggcggcgacctcgacgcggtcaggaaggcggtcacggcgggctacttccgc
cacgctgcgcggctgcagagggacgggtcgtaccgcgccgtgaagagccggcagacggtg
ttcgtccacccgagctccggggtggcgcaggcgccgccgcggtgggcgttgtaccacgag
ctggtgctcacgaccaaggagtacatgaggcaggtgacggagctcaagccggagtggctg
gtggagatcgcgccgcactactacgagcgcaaggacgtcgacgagcctgagcccaagaag
acggcggcggcgactacgccgcaagagcagacgacggccggctctacaccaacgaagcag
actccgaatctgaatagtttcttcgacgtgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345304
Entry
4345304           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1
  KO
K12813  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4345304
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4345304
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4345304
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    4345304
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    4345304
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 AAA_19 PWI T2SSE SRP54 TsaE Flavi_DEAD Sigma54_activ_2 ABC_tran
Other DBs
NCBI-GeneID: 4345304
NCBI-ProteinID: XP_015650435
LinkDB
Position
8:complement(14981406..14992332)
AA seq 1051 aa
MASDGQLRDWVSDKLMSLLGYSKSVVVQYVIRLAKECSSTGDLVGKLVEFGFTSSAETRS
FAADIYAKVPRKASGISNYQKQEREAAKLVKKQSTYKLLADEEDNDAETITSTSRQSSAS
TSSKSRKHFRRKAEDQDDGNDDDETKIKQDSGRNVKRRTEEVDDEDDGNDTDEEQERIRD
QQERAQLEKNMRERDAANTRKLMERQLSKEEQEEITRRSQAMDKNDTSDLRKFSRQAYLQ
KRRDKKIDEIRDEILDHEYIFQDVKLTEAEEKEFRYKKKIYDLVKEHVESADDVAEYKMP
EAYDMGDSVNQEKRFSVAMQRYKDPEARDKMNPFAEQEAWEEHQIGKSKLQFGSKDRKRS
SDDYQYVFEDGIDFVKSSVIEGTQHEEDSDQEDIDEKDMLKRELQDERKTLPIYKFRDEL
LKAVEEYQVIVIVGETGSGKTTQIPQYLHEAGYTAKGKVACTQPRRVAAMSVAARVSQEM
GVKLGHEVGYSIRFEDCTSEKTLIKYMTDGMLLREFLGEPDLASYSVVMVDEAHERTLST
DILFGLVKDISRFRPDLKLLISSATLDAEKFSDYFDSAPIFKIPGRRYPVEVHYTKAPEA
DYIDAAIVTVLQIHVTQPPGDILVFLTGQEEIETIDEILKHRTRGLGTKIAELLICPIYA
NLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVVDPGFCKIKSYNPRTGMESL
LINPISKASANQRAGRSGRTGPGKCFRLYTSYNYMHDLEDNTVPEIQRTNLANVVLTLKS
LGIHDLVNFDFMDPPPSEALLKALEQLFALSALNSRGELTKTGRRMAEFPLDPMLSKMIV
ASEKYKCSDEVISIASMLSVGNSIFYRPKDKQVHADNARLNFHTGNVGDHIALLNVYNSW
KETDYSTQWCYENYIQVRSMKRARDIRDQLEGLLERVEIEISSNASDLDAIKKAITSGFF
HHSSRLQKNGSYRTVKNPQTVFIHPSSGLAQVLPRWVIYHELVLTTKEYMRQVTELKPDW
LVEIAPHYYQLKDVDDTGTKKLPKGQGRAAL
NT seq 3156 nt   +upstreamnt  +downstreamnt
atggcgagcgacgggcagctcagggactgggtctccgacaagctcatgtccctcctcggc
tactccaagagcgtcgtcgtgcagtacgtcatcaggctggcgaaggagtgctcttccacc
ggcgacctcgtggggaagctcgtcgaatttgggttcacgtcctccgcggagacccggagc
ttcgccgcggacatctacgccaaggttcccaggaaggccagcggtatcagcaattaccag
aaacaggaaagagaggcagcaaagcttgtgaagaaacagagcacttacaaactgttggct
gatgaggaggacaacgatgctgaaaccatcacatcgacgagtcgacagagctccgcgagt
acatcctctaagagtagaaagcattttaggaggaaagctgaagaccaggacgatgggaat
gatgatgatgaaacaaaaataaaacaggattctgggaggaatgtgaaaagacgaacagaa
gaggtggatgatgaagatgatggtaatgatactgatgaagagcaagaaaggataagagat
cagcaggaaagagctcagctagaaaaaaacatgagagaaagagatgcagccaacactcga
aagttgatggagcgacagttatctaaggaggaacaagaggagatcaccaggagatctcaa
gcaatggacaagaatgacacttcagatctgagaaaattttcaaggcaagcctacttacag
aagagaagggacaaaaaaatcgatgagatcagggatgaaattctagatcatgagtacatt
tttcaggatgtgaaactaactgaagcagaagaaaaggagttcagatacaaaaagaagatt
tatgatcttgtgaaggagcatgttgagagtgcagatgatgttgctgagtacaaaatgcct
gaagcttatgacatgggtgacagtgtcaatcaagaaaagagattctctgtagcaatgcag
cgttacaaagatcctgaggccagggataaaatgaatccttttgctgaacaagaagcatgg
gaagagcaccaaataggaaagtctaaactgcaatttggatcaaaagataggaagcggtct
tctgatgattatcagtatgtattcgaagatggcattgattttgttaaatcttcagtcata
gaaggaacgcagcatgaagaagactcagatcaagaggatatcgatgaaaaggatatgtta
aaaagggagctccaggatgagcgtaaaactcttccaatctataaattcagggatgaactg
ctcaaggctgttgaagagtatcaggttattgtcatagtaggagaaactggctctggtaaa
acaacacaaatacctcaatatcttcatgaagctggatatacagcaaaaggaaaggtggca
tgtacacaacctcgtcgagttgcagcaatgagtgttgcagcgagggtgtcccaagagatg
ggcgttaaactaggacatgaggttggctactctataaggtttgaggattgcacgtctgag
aaaacattgattaagtatatgactgatggcatgcttctgagggagtttcttggcgaacca
gatttggcaagctatagtgttgttatggttgatgaggctcatgagcgtacactgtctact
gatatcttatttggtttggtgaaggatatttcacggtttcgaccagatctaaagttgctc
atttcaagtgcaacccttgatgcagaaaaatttagtgactactttgattcagctcctatt
ttcaagatacctgggaggcgatatcctgttgaagttcattatacaaaagctccagaagca
gattatatagatgcagccattgtcactgttttgcagatacatgtgacgcaaccccctggt
gatattcttgtattccttacaggacaagaagaaattgaaacaattgatgaaatccttaaa
cacagaacaagaggcttaggcacaaagattgcagaactacttatctgtcctatatatgca
aatctgccaactgaacttcaagctaagatatttgagcccaccccagagggtgctcggaag
gttgttctggccactaatatagcagagacttcattgaccattgatggtataaagtatgtc
gttgatccaggcttttgtaagatcaagtcatacaatccccgaacagggatggaatctcta
cttatcaaccctatctcaaaggcatcagcaaaccagagggcaggaagatctggacgcact
ggaccaggaaaatgcttccgcctgtacacaagttataattacatgcatgaccttgaggat
aatactgttccagagattcaaagaaccaaccttgcaaatgttgtgcttacacttaagagt
cttggtattcatgacttggttaactttgattttatggatccacctccatcagaggctcta
ttaaaggccctggaacaactctttgctctcagtgcactcaacagtcgtggagaattgacc
aagactggcagaagaatggcagagtttccattggaccctatgttgtcaaagatgatagta
gcttcagagaaatataagtgctctgatgaggtcatctccattgcatccatgttgtcagtt
ggcaattctatattctatcgtccaaaggataaacaagtgcatgcagacaatgcaaggttg
aacttccacactggcaatgttggggatcatatagctctactcaatgtttacaactcatgg
aaagaaacagactattcaacacagtggtgctatgaaaactatatacaggtccgcagcatg
aagagagcaagagatattcgtgatcaactggagggacttctagaaagagttgagattgag
atttcttcaaatgccagcgatttggatgctattaaaaaggctataacatcaggtttcttc
catcattcttcacggttgcagaagaatggttcatatagaactgttaagaaccctcaaact
gtatttattcatcctagttctggattagcacaggtacttcctcgatgggtaatataccat
gaattagtccttacaacaaaagaatatatgcgtcaggtaacggaactgaagcccgactgg
ctggtagaaatagcgccacactattatcaactaaaagacgttgacgacactgggactaag
aagctgcctaagggccaaggacgagctgcattgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268581
Entry
9268581           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1
  KO
K12813  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9268581
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    9268581
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9268581
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    9268581
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    9268581
SSDB
Motif
Pfam: AAA_30 Helicase_C AAA_19 AAA_16
Other DBs
NCBI-GeneID: 9268581
NCBI-ProteinID: XP_015629490
UniProt: Q10N49 C7J0I4
LinkDB
Position
3:9699177..9700391
AA seq 404 aa
MAGSNQEHEAESWPPAIYHQMPAILEYLEDHRVVVVSAAPGSGKSSVLPRCLAESGYGPV
LCAQPRHLAAFVAMAKVGEEWDSDIEFTTTRQLLDRFSSPAPVLAGYGAVVIDEAHDRTL
GTDVLLGMVKAALATGTTMGGRCKVVVCTAGGPADGMLSAFFGGAPVVSIPRAAHQVEVR
YSRGPVLDMAAAVADEVAAIHASQPPGDVLAFLPENADIIGVHARLLGLPVPGLAVRYVH
DNLPAELIDIMLINSPVPDGRRRVVLATDVAETAVLVHGITYVVDTGLVSEQPPVRISKE
AAAARAAIAGFSGPGRCHRLYQPEEYDDLDEHTIPHIRQDGAAVRFALMVKRHAADGIPG
FEIFDPALEPAVLKNVFGQLVNGGYLDKLGNLSDKGEREAYDED
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggccggctctaaccaagagcacgaggctgagtcgtggcctccggcaatctaccaccag
atgccggcgatccttgagtacctcgaagaccaccgtgtcgtcgtcgtctccgccgcgcct
ggctccggcaagtcgtcggtgctcccccggtgcctcgccgagagcggatacggcccggtg
ctctgcgcgcagccccgccacctggccgcgttcgtggccatggcgaaggtcggcgaggag
tgggattcggacatcgagttcacgacaacccggcagctcctcgacaggttcagctccccg
gcgccggtcctcgccgggtacggcgccgtcgtcatcgacgaggcgcacgaccgcacgctc
ggcaccgacgtcctcctcgggatggtcaaggccgcgctggcgacggggacgacgatgggc
ggccgatgcaaggtggtggtctgcaccgccggcgggccggccgacggcatgctctccgcc
ttcttcggcggcgcgccggtcgtctcgatcccgcgcgcggcgcaccaggtcgaggtgcgg
tactcgcgagggcccgtgctcgacatggcggccgcggtggccgacgaggtggcggccatc
cacgcgtcgcagccgcccggcgacgtgcttgcgttcctgccggagaacgccgacatcatc
ggcgtccacgcgaggctgctcggcctgccagtgccagggctggccgttcgctacgtccac
gacaacctcccggcggagctcatcgacatcatgctgataaactcgccggtgcccgacggc
cggaggagagtcgtgctggccaccgacgtggccgagacggccgtgctggtccacgggatc
acgtacgtcgtcgacaccggcctggtgtcggaacagccgccggtgaggatctcaaaggag
gcggcggccgcgcgggcggcgatcgccggattctcggggcccggccgctgccaccggctc
taccagccggaggagtacgatgatctcgacgagcacaccatcccacacatcaggcaagat
ggcgcggccgtcaggttcgcgctcatggtcaagcgacatgccgctgacggcatcccgggg
tttgagatttttgacccggcattggaaccggcagtgctgaagaatgtctttggtcagctt
gtcaacggtggctacttggacaagcttggaaatctgtctgacaagggggagagagaagca
tatgacgaagactag

DBGET integrated database retrieval system