KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338768
Entry
4338768           CDS       T01015                                 
Name
(RefSeq) 1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4338768
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4338768
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     4338768
SSDB
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh Transketolase_N
Other DBs
NCBI-GeneID: 4338768
NCBI-ProteinID: XP_015640505
UniProt: O22567
LinkDB
Position
5:complement(19957157..19963141)
AA seq 720 aa
MALTTFSISRGGFVGALPQEGHFAPAAAELSLHKLQSRPHKARRRSSSSISASLSTEREA
AEYHSQRPPTPLLDTVNYPIHMKNLSLKELQQLADELRSDVIFHVSKTGGHLGSSLGVVE
LTVALHYVFNTPQDKILWDVGHQSYPHKILTGRRDKMPTMRQTNGLSGFTKRSESEYDSF
GTGHSSTTISAALGMAVGRDLKGGKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVIL
NDNKQVSLPTATLDGPAPPVGALSSALSKLQSSRPLRELREVAKGVTKQIGGSVHELAAK
VDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLITILREVKSTKTTGPVLIHVVTEK
GRGYPYAERAADKYHGVAKFDPATGKQFKSPAKTLSYTNYFAEALIAEAEQDNRVVAIHA
AMGGGTGLNYFLRRFPNRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRGYDQVV
HDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELCHMVATA
AAIDDRPSCFRYPRGNGIGVPLPPNYKGVPLEVGKGRVLLEGERVALLGYGSAVQYCLAA
ASLVERHGLKVTVADARFCKPLDQTLIRRLASSHEVLLTVEEGSIGGFGSHVAQFMALDG
LLDGKLKWRPLVLPDRYIDHGSPADQLAEAGLTPSHIAATVFNVLGQAREALAIMTVPNA
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcgctcacgacgttctccatttcgagaggaggcttcgtcggcgcgctgccgcaggag
gggcatttcgctccggcggcggcggagctcagtctccacaagctccagagcaggccacac
aaggctaggcggaggtcgtcgtcgagcatctcggcgtcgctgtccacggagagggaggcg
gcggagtaccactcgcagcggccaccgacgccgctgctggacacggtcaactaccccatc
cacatgaagaacctgtccctcaaggagctccagcagctcgccgacgagctccgctccgac
gtcatcttccacgtctccaagaccgggggacatctcgggtccagcctcggcgtcgtcgag
ctcaccgtcgcgctccactacgtgttcaacacgcctcaggacaagatcctctgggacgtc
ggccaccagtcgtaccctcacaagattctgaccgggcggcgcgacaagatgccgacgatg
cgtcagaccaacggcttgtcgggattcaccaagcggtcggagagcgagtacgactccttc
ggcaccggccacagctccaccaccatctccgccgccctcgggatggcggtggggagggat
ctcaagggagggaagaacaacgtggtggcggtgatcggcgacggcgccatgacggccggg
caggcgtacgaggcgatgaataacgcggggtatctcgactccgatatgatcgtgattctc
aacgacaacaagcaggtgtcgctgccgacggcgacgctcgacgggccggcgccgccggtg
ggcgcgctcagcagcgccctcagcaagctgcagtccagccgcccactcagggagctcagg
gaggtggcaaagggcgtgacgaagcaaatcggagggtcggtgcacgagctggcggcgaag
gtggacgagtacgcccgcggcatgatcagcggctccggctcgacgctcttcgaggagctc
ggcctctactacatcggccccgtcgacggccacaacatcgacgacctcatcaccatcctc
cgcgaggtcaagagcaccaagaccacaggcccggtgctcatccacgtcgtcaccgagaaa
ggccgcggctacccctacgccgagcgcgccgccgacaagtaccacggcgtggcgaagttc
gatccggcgacggggaagcagttcaagtcgccggcgaagacgctgtcgtacacgaactac
ttcgcggaggcgctcatcgccgaggcggagcaggacaacagggtcgtggccatccacgcg
gccatggggggaggcacggggctcaactacttcctccgccgcttcccgaaccggtgcttc
gacgtcgggatcgccgagcagcacgccgtcacgttcgccgccggcctcgcctgcgagggc
ctcaagccgttctgcgccatctactcctccttcctgcagagaggctacgaccaggtggtg
cacgacgtggacctccagaagctgccggtgaggttcgccatggacagggccgggctcgtg
ggcgccgacgggccgacgcactgcggcgcgttcgacgtcacctacatggcgtgcctgccg
aacatggtcgtcatggccccgtccgacgaggcggagctctgccacatggtcgccaccgcc
gcggccatcgacgaccgcccctcctgcttccgctacccaagaggcaacggcatcggcgtc
ccgctaccacccaactacaaaggcgttcccctcgaggtaggcaaagggagggtactgctg
gagggcgagagggtggcgctgcttgggtacggttcggcggtgcagtactgcctcgccgca
gcgtcgctggtggagcggcacggcctcaaggtgaccgtcgccgacgcgaggttctgcaag
ccgctggaccaaacgctcatcaggaggctggccagctcccacgaggtgctcctcaccgtc
gaggaaggctccatcggcgggttcggctcccacgtcgcgcagttcatggccctcgacggc
ctcctcgacggcaaactcaagtggcggccgctggtgctacccgacaggtacatcgaccac
gggtcaccggcggatcagctggcggaggcagggctgacgccgtcgcacatcgcggcgacg
gtgttcaacgtgctgggccaggcgagggaggcgctcgccatcatgacggtgcccaacgcg
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340090
Entry
4340090           CDS       T01015                                 
Name
(RefSeq) probable 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic isoform X1
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4340090
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4340090
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     4340090
SSDB
Motif
Pfam: DXP_synthase_N Transketolase_C Transket_pyr
Other DBs
NCBI-GeneID: 4340090
NCBI-ProteinID: XP_015642490
LinkDB
Position
6:complement(2251017..2256638)
AA seq 722 aa
MGGRYLHSPPAVNLICEESTFVRSTSCCLHSCLCLRCKTSNLKPCRTLVFNMPSRRFNRR
VAALPDVDDFFWEKDPTPILDTIDAPIHLKNLSSKELKQLAGEVRSEISFIMSRKCQPCN
TGHSVVELAIAIHYVFNAPMDKILWDAGQHTYAHKILTGRRSLFHTIKQRKGLSGFTSRF
ESEYDPFGAGHGCNSLSAGLGMAVARDLGGRKNRIVTVISNWTTMAGQVYEAMGHAGFLD
SNMVVILNDSRHTLLPKADSQSKMSINALSSALSKVQSSKGFRKFREAAKGLSKWFGKGM
HEFAAKIDEYARGMIGPHGATLFEELGLYYIGPIDGNNIDDLICVLKEVSTLDSTGPVLV
HVITENEKDSGGEFNSEITPDEEGPPDSSQDILKFLENGLSRTYNDCFVESLIAEAENDK
HIVVVHGGMGIDRSIQLFQSRFPDRFFDLGIAEQHAVTFSAGLACGGLKPFCIIPSTFLQ
RAYDQIVEDVDMQKIPVRFAITSAGLVGSEGPTNSGPFDITFMSCLPNMIVMSPSNEDEL
IDMVATAAMVEDRPICFRYPKGAIVGTSGTLAYGNPLEIGKGEILAEGKEIAFLGYGDVV
QRCLIARSLLFNFGIQATVANARFCKPLDIDLIRMLCQQHDFLITVEEGTVGGFGSHVSQ
FISLDGLLDGKIKWRPIVLPDRYIEHASLTEQLDMAGLTAHHIAATALTLLGRHRDALLL
MK
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgggtgggagatatctgcattctccacctgctgttaatttaatctgtgaggaatcaact
tttgtgcgctcaacaagttgctgtctccactcttgtctgtgtttgagatgcaaaacatcg
aatttgaagccatgtcgaacactggtgttcaatatgccatcaaggcgcttcaatagaaga
gtggctgcgctgccagatgtcgatgatttcttttgggagaaggatccaactccaatcctg
gacacgatcgatgcacccatccatttgaaaaatctatctagtaaggagttaaagcaacta
gctggtgaagttcgatcggagatatctttcataatgtcgaggaaatgccaaccatgtaac
actggacattctgttgtggagctcgctattgctatacattatgtcttcaatgccccaatg
gataagatattatgggatgctggtcagcatacatatgcacacaagattctcacaggaagg
cgctcactctttcatactattaagcaaagaaaggggctttcaggtttcacatcccgtttc
gagagcgaatatgatccctttggtgcaggacatggatgcaatagtctctccgcaggcctt
gggatggcagtcgcaagggatctaggtgggaggaaaaaccgaatagtaacagttataagt
aactggacaactatggctggtcaggtgtatgaggcaatgggtcatgccggtttccttgat
tctaacatggtagtgattttaaatgacagccggcacaccttgcttcctaaagcagatagc
caatcaaagatgtctattaatgccctctctagtgctctgagcaaggttcaatccagcaaa
ggatttagaaagtttagggaggctgcaaagggactttccaaatggtttggtaaagggatg
catgaatttgctgccaaaattgatgagtatgcccgtggtatgataggtcctcatggagca
actctttttgaagaacttggattatattatattgggcctattgatgggaataacattgat
gatctcatttgtgtactcaaggaggtttctactctagattctaccggcccagtacttgtg
catgtaatcactgagaatgaaaaagactcaggtggagaatttaatagtgagattactccc
gacgaggaagggcctccagactcaagccaagacattctaaagtttttagaaaatggtctt
tctaggacatataatgattgctttgtagaatcactaatagcagaagcagagaatgacaag
catattgtggtggttcatggaggcatgggaatagatcgatcaatccaattatttcagtcc
agatttccggacagatttttcgatttgggtatcgccgagcaacatgctgttacgttttct
gctggtttggcatgcggaggcttaaagcctttctgcataattccatccacctttctccag
cgagcatatgatcagatagtcgaagatgtggacatgcaaaagataccagttcgctttgca
atcacaagtgcaggtctggtgggatctgaaggcccgactaactcaggaccatttgatatt
acattcatgtcatgcctgccaaacatgatcgtcatgtcaccatctaatgaggatgaactt
attgacatggtggcaacagctgcaatggttgaggacagacccatttgcttccggtatccc
aagggtgccatcgttgggactagtggcactttagcatatgggaatccacttgagattggt
aaaggagagattcttgctgaggggaaagagatagcttttcttggttatggtgatgtggtc
cagagatgcttgatagctcgatctcttctgttcaactttggcatccaggcaactgttgct
aatgcgagattttgcaagccacttgacattgatctgataagaatgttgtgccagcaacac
gatttcctaatcaccgtggaagaaggaacggttggtggttttggctcacacgtctcgcaa
tttatttcactcgatgggttgcttgatggcaaaataaagtggcgacccattgtactacca
gacaggtacatcgaacacgcttcgctcacagagcagctcgacatggctgggttgactgct
catcacatcgcagcaaccgcactgacccttttagggcgacaccgagacgcacttttgttg
atgaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342614
Entry
4342614           CDS       T01015                                 
Name
(RefSeq) probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4342614
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4342614
Enzymes [BR:osa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     4342614
SSDB
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C Transketolase_N PFOR_II
Other DBs
NCBI-GeneID: 4342614
NCBI-ProteinID: XP_015647944
UniProt: Q6YU51
LinkDB
Position
7:4821213..4824667
AA seq 713 aa
MALQASSSPSMFRAIPTNTNASCRRKLQVRASAAAAAANGGGDGKVMMRKEAASGAWKID
YSGEKPATPLLDTVNYPVHMKNLSTPELEQLAAELRAEIVHTVSKTGGHLSSSLGVVELA
VALHHVFDTPEDKIIWDVGHQAYPHKILTGRRSRMHTIRQTSGLAGFPKRDESAHDAFGA
GHSSTSISAALGMAVARDLLGKKNHVISVIGDGAMTAGQAYEAMNNSGYLDSNMIVVLND
NKQVSLPTATLDGPATPVGALSKALTKLQSSTKLRRLREAAKTVTKQIGGQAHEVAAKVD
EYARGMVSASGSTLFEELGLYYIGPVDGHSVDDLVAIFNKVKSMPAPGPVLVHIVTEKGK
GYPPAEAAADRMHGVVKFDPTTGRQFKSKCSTLSYTQYFAEALIREAEADDKVVGIHAAM
GGGTGLNYFHKRFPERCFDVGIAEQHAVTFAAGLAAEGLKPFCAIYSSFLQRGYDQVVHD
VDLQRLPVRFAMDRAGLVGADGPTHCGAFDVAYMACLPNMVVMAPADEAELMHMVATAAA
IDDRPSCFRFPRGNGIGAVLPPNHKGTPLEVGKGRVLVGGNRVALLGYGTMVQACMKAAE
ALKEHGIYVTVADARFCKPLDTGLIRELAAEHEVLVTVEEGSIGGFGSHVAHYLSLSGLL
DGPLKLRSMFLPDRYIDHGAPVDQLEEAGLTPRHIAATVLSLLGRPLEALQLS
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggcgctccaggcatcgtcgtcgccgtccatgttccgcgcgatcccgacgaacaccaac
gcttcttgccggcgaaagttgcaggtcagggcgagcgcggcggcggcggcggcgaacggc
ggcggggatgggaaggtgatgatgaggaaggaggcggcgtcgggcgcgtggaagatcgac
tactccggcgagaagccggcgacgcctctgcttgacacggtgaactacccggtccacatg
aagaacctctcgacgccggagctggagcagctggcggcggagctccgggcggagatcgtg
cacacggtgtccaagaccgggggccacctgagctccagcctgggcgtcgtcgagctcgcc
gtggcgctgcaccacgtgttcgacacgccggaggacaagatcatctgggacgtcgggcac
caggcgtacccgcacaagatcctgacggggcggcgttcgcggatgcacaccatccggcag
acctccgggctcgccgggttcccgaagcgcgacgagagcgcgcacgacgcgttcggcgcg
ggccacagctcgacgagcatctcggcggcgctcgggatggcggtggcgagggacctcctc
gggaagaagaaccacgtcatctcggtgatcggcgacggcgccatgaccgccggccaggcg
tacgaggcgatgaacaactcgggctacctcgactccaacatgatcgtggtgctcaacgac
aacaagcaggtgtccctcccgacggcgacgctcgacggccccgccacgcccgtcggcgcg
ctgagcaaggcgctgacgaagctccagtcgagcaccaagctccgccgcctccgcgaggcg
gcgaagacggtgacgaagcagatcggcgggcaggcgcacgaggtggcggcgaaggtggac
gagtacgcgcgcggcatggtgagcgcgtcgggctcgacgctgttcgaggagctcgggctc
tactacatcggccccgtcgacggccacagcgtcgacgacctcgtcgccatcttcaacaag
gtgaagtcgatgccggcgccggggccggtgctcgtccacatcgtgacggagaaggggaag
ggctacccgccggcggaggccgccgccgaccggatgcacggcgtggtcaagttcgacccg
acgacggggaggcagttcaagtccaagtgttcgacgttgtcctacacccagtacttcgcc
gaggcgctgatccgggaggccgaggccgacgacaaggtggtcggcatccacgccgccatg
ggcggcggcacggggctcaactacttccacaagaggttcccggagcggtgcttcgacgtg
gggatcgcggagcagcacgccgtgacgttcgccgcggggctcgccgccgaggggctcaag
ccgttctgcgccatctactcgtcgttcctgcagcgagggtacgaccaggtggtgcacgac
gtcgacctgcagcggctgccggtgaggttcgccatggacagggcggggctcgtcggcgcc
gacgggcccacgcactgcggcgcgttcgacgtcgcctacatggcgtgcctgccgaacatg
gtcgtcatggcgcccgccgacgaggccgagctcatgcacatggtcgccaccgccgcagcc
atcgacgaccgccctagctgcttccgcttcccccgcggcaatggcattggcgccgtcctc
cctcccaaccacaagggcacacctctcgaggtcgggaaggggagggtgctcgtaggaggg
aacagggtggcgctgctagggtacggcacgatggtgcaggcatgcatgaaggcggcagag
gcgctgaaggagcacggcatctacgtcaccgtcgccgacgcgcgtttctgcaagccgctc
gacacagggcttatccgggagctcgctgccgagcacgaggtcctcgtcactgtggaggag
ggctccatcggagggttcggttctcacgtcgcccactacctcagcctcagcggcctcctc
gatggccccctcaagttgaggtccatgttcttgccagacaggtacatagaccatggtgca
ccagtagaccagcttgaggaggcaggattgacaccaaggcacattgctgccactgtgctg
tccttgcttgggaggccattggaggcacttcagctcagctga

DBGET integrated database retrieval system