KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338791
Entry
4338791           CDS       T01015                                 
Name
(RefSeq) isopentenyl-diphosphate Delta-isomerase I
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
osa_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4338791
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     4338791
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 4338791
NCBI-ProteinID: XP_015637711
UniProt: Q6AUB0 A0A0N7KKS3
LinkDB
Position
5:20210317..20213582
AA seq 293 aa
MAAAARSLALLSTASASLGLGVARSSARPRSPFGRGLALRGLSSSSSSFAATAAVMGKAG
TAEAADAGMDAVQQRLMFEDECILVDEQDNVIGHDSKYNCHLMEKINSGHVLHRAFSVFL
FNSKYELLLQQRSATKVTFPLVWTNTCCSHPLYRESELIEDKSLGVRNAAQRKLFDELGI
QAEELPVDQFIPLGRMLYKAPSDGKWGEHELDYLLFMVRDVELSPNPEEVADVKYVNRDE
LKELLKKADAGEGGIKLSPWFRLVVDNFLMRWWDHVEQGTLEEAIDMKTIHKL
NT seq 882 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgcgctccctcgcgctgctctcgaccgcctccgcgtccctcggcctc
ggcgtcgcgcgctcctccgcccgccctcggtccccgtttgggcggggcctcgccctccgc
ggcctgtcgtcgtcctcgtcctccttcgccgccaccgccgcggtgatggggaaggccggc
accgcggaagccgccgacgccgggatggacgccgtccagcagcggctcatgttcgaggac
gagtgtattttagtggacgaacaggacaacgtcattggccatgattccaagtataactgc
catctcatggaaaagataaattctggtcatgtcctccacagagcgttcagtgtttttctt
ttcaactccaaatatgaattgttacttcagcaaaggtctgctacaaaagtgacatttcca
cttgtctggacaaacacttgctgtagccaccctctataccgcgagtccgagctcattgaa
gataaaagcctaggggtcagaaatgcagcacagcggaagctattcgatgaactgggaata
caagctgaagaactacctgttgaccaattcattcctcttgggaggatgctttacaaggct
ccatctgatggaaaatggggcgaacatgaactggactacctcctattcatggttcgtgat
gtggagctcagcccgaatcctgaagaagtggccgacgtcaagtacgtgaatcgtgatgag
ctgaaggagttgctcaagaaggcagatgctggtgaaggcggcattaagctgtccccttgg
tttaggctggttgttgacaacttcctcatgagatggtgggatcatgttgagcaagggact
ctggaggaggccatcgacatgaaaacaattcataagttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343523
Entry
4343523           CDS       T01015                                 
Name
(RefSeq) isopentenyl-diphosphate Delta-isomerase I
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
osa_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4343523
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     4343523
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 4343523
NCBI-ProteinID: XP_015646798
UniProt: A0A0P0X7B7 Q8GVZ0
LinkDB
Position
7:21625606..21628798
AA seq 238 aa
MAGAAAAVEDAGMDEVQKRLMFDDECILVDEQDNVVGHESKYNCHLMEKIESENLLHRAF
SVFLFNSKYELLLQQRSATKVTFPLVWTNTCCSHPLYRESELIQENYLGVRNAAQRKLLD
ELGIPAEDVPVDQFTPLGRMLYKAPSDGKWGEHELDYLLFIVRDVKVVPNPDEVADVKYV
SREQLKELIRKADAGEEGLKLSPWFRLVVDNFLMGWWDHVEKGTLNEAVDMETIHKLK
NT seq 717 nt   +upstreamnt  +downstreamnt
atggccggcgccgccgccgccgtggaggacgccgggatggacgaggtccagaagcggctc
atgttcgacgacgaatgcattttggtggatgaacaagacaatgttgttggccatgaatca
aaatataactgccatctgatggaaaaaatcgaatctgaaaatctacttcatagggctttc
agtgtattcctgttcaactcaaaatatgaactcctactccagcaacgatctgcaacaaag
gttacatttcctctagtttggaccaacacttgctgcagccatcctctgtaccgtgagtct
gagcttatacaggaaaactaccttggtgttagaaatgctgctcagaggaagctcttggat
gagctgggcatcccagctgaagatgtgccagttgaccaattcacccctcttggtcggatg
ctttacaaggccccatctgatggaaaatggggtgaacacgagcttgactacctgctgttc
atcgtccgcgacgtgaaggtagtcccgaacccggacgaagtggccgatgtgaaatacgtg
agccgtgagcagctgaaggagctcatccgcaaagcggacgccggagaggaaggcctgaag
ctgtctccctggttccggctggttgttgacaacttcctcatgggctggtgggatcacgtc
gagaaaggcaccctcaacgaggccgtggacatggagaccatccacaagctgaagtaa

DBGET integrated database retrieval system