KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338898
Entry
4338898           CDS       T01015                                 
Name
(RefSeq) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ isoform X1
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4338898
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    4338898
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4338898
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     4338898
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4338898
SSDB
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Other DBs
NCBI-GeneID: 4338898
NCBI-ProteinID: XP_015640704
LinkDB
Position
5:21322791..21325365
AA seq 229 aa
METAAMPRSPCCSLPSARVLPSRLPLLPRPAPAALSAPAARPVVARCAAAAGHGGEGEMP
IEKRFPPFPAVMDINQIRDILPHRFPFLLVDRVIDYKPGEYAVGIKNVTINDNFFPGHFP
ERPIMPGVLMVEVYIDFVCHFYLDVQAMAQVGGLVMLQPEVGGSRENFFFAGIDKVRFRK
PVIAGDTLIIRMTLIKLQKRFGIAKMEGKAYVGGDLVCEGEFLMATGSE
NT seq 690 nt   +upstreamnt  +downstreamnt
atggagaccgcggcgatgccaagatctccgtgctgctccctcccctccgcccgtgtcctc
ccctcccgccttcccctcctgccccgccccgcgccggcggctctctcggccccggccgcc
aggccggtcgtggcccggtgcgccgccgccgccggccacgggggcgagggcgagatgccc
atagagaagaggtttcctcccttcccggctgtgatggacatcaaccaaatccgcgatatc
ttgccgcacaggtttccattccttctggttgatagagtgattgattacaagccaggggaa
tatgctgttgggatcaagaatgttacaataaatgataacttcttcccagggcattttccg
gagagacctataatgcctggtgttcttatggtggaggtatacattgattttgtttgccat
ttttaccttgatgtgcaggcaatggcccaggttggaggtctggttatgttgcaacctgaa
gttggtggatctcgagagaacttcttttttgcagggattgataaagtgagatttcgtaag
cctgtgattgctggagacaccttgattataaggatgactctgatcaagttgcagaagagg
tttggaatcgcaaagatggaaggaaaagcatatgttggaggcgacctagtatgtgaggga
gagttcttgatggcaaccggatctgaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344973
Entry
4344973           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4344973 isoform X1
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4344973
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    4344973
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4344973
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     4344973
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4344973
SSDB
Motif
Pfam: FabA
Other DBs
NCBI-GeneID: 4344973
NCBI-ProteinID: XP_015650485
LinkDB
Position
8:complement(7610374..7614955)
AA seq 245 aa
MEATAAAAAAPARSALPFRSRVAAAARPGRAPALSAAPGRRLVARRAAGDGQAVEAQEAL
PIEKRFPPFPSVMDINQIREILPHRFPFLLVDRVIEYKGGEYAVGIKNVTINDNFFPGHF
PERPIMPGVLMVEDGEIPNTMEEEKPSAGVQPDPTVPTMALSWMLPTQGQETIHDTMNTA
YEMSSSETPPLRADQAAAAAPMDVEVQLRQRQPQAPPCQQAHFWSVSNDEDMWAGYWKYL
VSSEL
NT seq 738 nt   +upstreamnt  +downstreamnt
atggaggccaccgccgccgccgccgcagcgcccgcgagatccgcgctccccttccggagc
cgcgtcgccgccgcagcacgcccaggacgcgcgccggcgctgtcggccgccccgggaagg
cgcctcgtcgcgcgccgcgccgcgggcgacggccaggcggtggaggctcaggaggcgctc
cccatcgagaaaaggttccctcccttcccgagcgtcatggacatcaaccagatccgcgag
atcctgccccacaggtttccattcctcctggttgatagagttattgagtacaagggagga
gaatatgcagttgggatcaagaatgtcacgataaatgataacttcttccctgggcatttc
cccgaacgacccataatgcctggtgttctcatggttgaggatggtgagattccaaacacg
atggaggaagagaaaccatcagcaggtgttcaacctgatcctactgtgccaaccatggcc
ttatcatggatgctaccaactcagggccaagagactatccatgacactatgaacactgca
tatgagatgtcatcttcagaaacgccgccactcagagcagaccaagccgccgccgcggcg
ccgatggacgtcgaggttcagctccggcagcggcagcctcaggcgccgccgtgtcagcag
gctcatttctggtcagttagtaatgatgaagacatgtgggctggatattggaaatatttg
gtttcttctgagctgtaa

DBGET integrated database retrieval system