KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339063
Entry
4339063           CDS       T01015                                 
Name
(RefSeq) UDP-sugar pyrophosphorylase isoform X1
  KO
K22920  UTP---glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4339063
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     4339063
SSDB
Motif
Pfam: UDPGP
Other DBs
NCBI-GeneID: 4339063
NCBI-ProteinID: XP_015639560
LinkDB
Position
5:22996911..23005545
AA seq 866 aa
MASRTLPPPHLRLDLCSPRLPPLRSPGCRRRRRRGRVLSALSSPSPSPSSASRSQSVSTA
PLERGVGPGPATSREQPRGGGDLALAAELARLSALRARLRGARSLADKLRALDAETRVVE
FFGEGSNGGVLGALEPREVFLLKCLVAAGQEHVLGAELDWDGRGHEHHHHHNGGSDGRSA
LRQALSSLAALVGKWSSEGVVEGVAESGESELLRRLLKFLGDIDVFYDCIGGIIGYQIMA
LELLSASKDHKHRPSKHKSIDFHVPSGLNLLEDTEYASQAALWGIEGLPELGEIYPIGGA
GDRLGLVDSDTGESLPAALLPYCGRSLLEGLIRDLQAREFLHFKIFGKQCITPVAIMTSS
VKDNHEHITAICERLEWFGRGRENFRLFEQPLVPVVNAKDGKWLTSGALFPVGKPGGHGA
IWKLACDRGIFQWLYQNGRKGATVRQVSNVVAATDLTLMALAGIGLRHDKKLGFASCERR
PGATEGVNVLIEKENQDGQWAYGITCIEYTEFEKYGIPEPTVTNGSLQANYPANTNILYV
DLQAAEEVGSRKNASCLPGMVLNLKKAVSYLDHLGFECSAAGGRLECTMQNIADNFMNTY
NYRCSKGIESELDTFIVYNERKKVTSSAKRKLKSEDKSLHQTPEGSLLDIMRNAYDLLSS
CNVKVPKVKDNCEYLRSGPPFLIFLHPALGPFWDITRQKFVGGSVSQGSELQIEVAEFLW
QDVELDGSLIVLADNIMGSTNKNNTGEQIMHYGARCGRCKLQSVKIVNKGINWSSANNVY
WKHDVERSESVKIILHENAEFEAKDVVLKGNHIFEVPTGHRMRIVQDGPEFVAKLDPISK
EMMDSGTWYWKYAVDGAHVKLEMVEL
NT seq 2601 nt   +upstreamnt  +downstreamnt
atggcctctcgcacgctgcctccaccccacctccgcctcgacctctgctcgccccgcctc
ccgccgctccgctcccccggctgccgccgccgccgccgccgtggacgtgtcctctccgcg
ctctcctccccatccccgtccccgtcctcggcctcccgctcgcagagcgtctccaccgcg
ccactcgagcgaggggttgggcccgggccggccacctcccgcgagcagccgcgcggcggc
ggggacctggcgctcgcggcggagctcgcgcgcctctccgccctgcgcgcgcgcctccgc
ggggctcgctccctcgccgacaagctccgcgcgctcgacgccgagacccgggtggtcgag
ttcttcggggaggggtcgaatggtggggttctgggcgcgctcgagccgcgggaggtgttc
ctgctcaaatgcctagtcgccgccggccaggaacacgtgctcggcgcggagctcgactgg
gacggtcgcggccacgagcaccatcaccaccataacggcgggagcgatggtcggagcgcc
ctgcggcaggcgctgtctagcttggctgctttggtcggcaagtggagctcggagggagtg
gtggagggtgtggcggagagcggggaatcggagcttctccggcgtctgctcaaattcctc
ggcgacatcgacgtgttctatgactgcattggaggcatcatcggctatcagattatggca
ttggagttgctttcagcctcgaaggaccacaagcaccggcctagcaaacacaagtctatt
gacttccatgttccaagtggacttaatctattggaagatacggaatatgcatctcaagct
gctctgtgggggattgagggtttgccagaactaggagagatttatccgattggtggtgct
ggtgatcgtcttggtttagtggactcggatactggtgaatccctccctgctgcattgctt
ccttattgtgggagatctctattagaaggcctcatacgtgatctgcaggctagggaattt
ttgcatttcaagatttttgggaaacaatgtataactcctgtcgcgatcatgacaagctct
gtgaaggataaccatgagcatataactgcaatatgtgaaagacttgaatggtttggcaga
ggccgtgagaatttccgcttatttgaacagcctttggtacctgtagtaaatgctaaggat
ggtaaatggttaaccagcggagcactttttcctgttggtaagcctggtggtcatggtgct
atttggaaacttgcatgtgatagaggtatattccaatggctttaccaaaatggcagaaaa
ggcgcaactgtacgtcaagtcagcaatgttgtggctgcaactgatttaacactgatggca
ttggcaggaataggcctgcgtcacgataagaaattaggttttgcgtcttgtgaacgaaga
ccaggtgctactgaaggggtaaatgtactaatcgaaaaagaaaaccaggatggacaatgg
gcatatggtatcacttgcattgaatacactgagtttgaaaaatatggcatcccagaacca
acagtaacaaatggcagtttgcaggctaactatccagcaaatacaaatatactatatgtt
gatctgcaagcagcagaggaagttggttcgcgcaaaaatgctagctgtttacccggaatg
gtgctaaatttgaaaaaagctgtgtcatacttggatcatctgggctttgagtgtagtgct
gctggaggcaggttagaatgcacgatgcaaaacatagcggataattttatgaacacatat
aactacaggtgcagtaaaggaatagaaagtgagctagacacattcattgtgtacaacgaa
aggaaaaaagtcacttcgtcagctaaaaggaagctgaaatcagaagataagtcattgcac
cagactccagagggttcactccttgacattatgcgtaatgcttatgatctcctttctagc
tgcaatgtaaaggttcccaaggtcaaagacaactgtgaatacttgcgttctggaccacct
tttcttatatttcttcatcctgctttaggtccattttgggatatcacaaggcagaagttt
gtaggtggctcggtctctcaaggttcagaattgcaaatagaggtggcagaatttctatgg
caagatgttgagctcgatggaagcctaatcgttttagctgacaatattatgggttcaacc
aacaagaataatactggagaacaaataatgcactatggtgccaggtgtgggagatgcaaa
ctgcaaagtgttaaaattgtgaataaagggatcaactggagttctgccaataatgtctac
tggaagcatgatgtcgagagatcagaatctgtgaagatcattcttcatgaaaatgccgaa
tttgaggcaaaagatgttgtccttaagggtaaccatatctttgaagttcccactggtcat
agaatgcgcattgttcaagatggaccagaatttgttgctaagttagatcccataagcaag
gaaatgatggacagtggaacctggtactggaagtatgcagtagatggagctcatgtgaag
ttggaaatggtagaactataa

DBGET integrated database retrieval system