KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339188
Entry
4339188           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 98A1
  KO
K09754  5-O-(4-coumaroyl)-D-quinate 3'-monooxygenase [EC:1.14.14.96]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4339188
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4339188
   00941 Flavonoid biosynthesis
    4339188
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4339188
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.96  5-O-(4-coumaroyl)-D-quinate 3'-monooxygenase
     4339188
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP98 family
   4339188
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4339188
NCBI-ProteinID: XP_015639951
UniProt: Q0DH37 A0A0P0WNZ0
LinkDB
Position
5:24271083..24275164
AA seq 512 aa
MDVASLLPFALALVAIPISLALLDRLRLGRIPPGPRPWPMVGNLWQIKPVRCRGFLEWAE
RYGPIVSVWFGSSLNVVVSTSELAKEVLKENDQLLADRPRNRSTQRFSRNGMDLIWADYG
PHYIKVRKLCNLELFTPKRLEALRPIREDEVTAMVESVHRAVTQPGSEHKPIVVRNHLAM
VAFNNITRLAFGKRFMNANGDIDEQGREFKTIVNNGIKIGASLSVAEYIWYLRWLCPLNE
ELYKTHNERRDRLTKKIIDEHAKALKESGAKQHFVDALFTLREQYDLSDDTVIGLLWDMI
TAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVMSETDFQSLPYLNAVVKES
LRLHPPTPLMLPHKASTNVKIGGYNIPKGANVMVNVWAIARDPKVWSNPLEYRPERFIEE
NIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLHQFEWSLPEGTRPEDVNMMES
NGVVTFMSTSLQVIAKPRLDNPDLYKRFPVEM
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggacgtcgcgtcgctgctcccgttcgcgctggcgctggtggcgatcccgatctcgctg
gcgctgctggaccggctgcggctggggcggatcccgccggggccgcggccgtggccgatg
gtggggaacctgtggcagatcaagccggtgcggtgccgcggcttcctggagtgggcggag
aggtacggcccgatcgtgtcggtgtggttcggctcgtcgctgaacgtggtggtgtcgacg
tcggagctcgccaaggaggtgctcaaggagaacgaccagctgctcgccgaccggccgcgc
aaccgctccacgcagcgcttcagccgcaacgggatggacctgatctgggcggactacggc
ccgcactacatcaaggtgcgcaagctctgcaacctcgagctcttcacccccaagcgcctc
gaggccctccgccccatccgcgaggacgaggtcaccgccatggtcgagtccgtccaccgc
gccgtcacccagccaggtagtgaacataaaccaatcgtagtgaggaatcaccttgctatg
gtggccttcaacaatataacaaggctagctttcggcaagaggttcatgaatgcaaatggt
gacattgatgaacaagggcgtgagtttaagactattgtcaacaatggaatcaagatcggt
gcatctctttctgttgctgagtacatttggtatttgaggtggttgtgtccacttaacgag
gagctttacaagacccacaacgagagaagggatcggctgaccaagaagatcatagatgag
catgcgaaggccctcaaggagagtggtgccaagcagcactttgtggatgctctgttcact
ctcagagaacagtatgaccttagtgacgacacagttattgggcttctatgggacatgatc
actgctggaatggacaccacagtgatatcagtcgagtgggcaatggcagagctggtcagg
aaccccagggtgcagaagaagctgcaggaggagctggaccgcgtcgtcggccgcgaccgc
gtcatgtcggagaccgacttccagagcctcccttacctgaacgccgtcgtcaaggagtcg
ctccggctgcacccgccgacgccgctgatgctcccgcacaaggccagcacgaacgtcaag
atcggcgggtacaacatccccaagggcgccaacgtgatggtgaacgtgtgggcgatcgcc
agggaccccaaggtgtggagcaacccgctggagtacaggccggagcggttcatcgaggag
aacatcgacatcaagggcagcgacttcagggtgctccccttcggcgccggccgccgcgtg
tgccccggcgcccagctcggcatcaacctcgtcgcctccatgatcgggcacctcctccac
cagttcgagtggtctctccccgagggcaccaggccggaggacgtcaacatgatggagtcc
aacggcgtcgtcacgttcatgagcacgtcgctgcaggtcatcgccaagcccaggctcgac
aacccggacctgtacaagaggttccctgtcgagatgtga

DBGET integrated database retrieval system