KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339261
Entry
4339261           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L38
  KO
K02923  large subunit ribosomal protein L38e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339261
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4339261
SSDB
Motif
Pfam: Ribosomal_L38e
Other DBs
NCBI-GeneID: 4339261
NCBI-ProteinID: XP_015640801
UniProt: Q75IN7
LinkDB
Position
5:25052457..25054155
AA seq 69 aa
MPKQIHEIKDFLLTARRKDARSVRIKRSKDAVKFKVRCSRYLYTLCVHDTDKANKLKQSL
PPGLTVQEV
NT seq 210 nt   +upstreamnt  +downstreamnt
atgccgaagcaaatccatgagatcaaggacttccttctcacagcgaggaggaaggatgcc
cgctccgtgaggatcaagaggagcaaggatgccgtcaagttcaaggtgcgctgctccagg
tacctctacacgctgtgtgtacatgacactgacaaggccaacaagctgaagcagtctctc
cccccaggcttgaccgttcaggaggtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343529
Entry
4343529           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L38
  KO
K02923  large subunit ribosomal protein L38e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343529
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343529
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4343529
SSDB
Motif
Pfam: Ribosomal_L38e
Other DBs
NCBI-GeneID: 4343529
NCBI-ProteinID: XP_015647594
UniProt: Q0IT01 Q8GVY2
LinkDB
Position
7:complement(21672590..21674215)
AA seq 69 aa
MPKQIHEIKDFLLTARRKDARSVRIKRTKDAVKFKVRCSKYLYTLCVFDADKANKLKQSL
PPGLTVQEV
NT seq 210 nt   +upstreamnt  +downstreamnt
atgccgaagcagatccacgagatcaaggacttcctcctgacggcgaggaggaaggacgcg
aggtcggtgcggatcaagaggaccaaggacgccgtcaagttcaaggtgcgctgctccaag
tacctctacaccctctgcgtcttcgacgccgacaaggccaacaagctcaagcagtcgctt
cccccgggtttgactgtccaggaggtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350406
Entry
4350406           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L38
  KO
K02923  large subunit ribosomal protein L38e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4350406
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4350406
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4350406
SSDB
Motif
Pfam: Ribosomal_L38e
Other DBs
NCBI-GeneID: 4350406
NCBI-ProteinID: XP_015617721
UniProt: Q0IT01 Q8GVY2
LinkDB
Position
11:14044162..14045788
AA seq 69 aa
MPKQIHEIKDFLLTARRKDARSVRIKRTKDAVKFKVRCSKYLYTLCVFDADKANKLKQSL
PPGLTVQEV
NT seq 210 nt   +upstreamnt  +downstreamnt
atgccgaagcagatccacgagatcaaggacttcctcctgacggcgaggaggaaggacgcg
cggtcggtgcggatcaagaggaccaaggacgccgtcaagttcaaggtgcggtgctccaag
tacctctacaccctctgcgtcttcgacgccgacaaggccaacaagctcaagcagtcgctc
cccccaggtttgactgtccaggaggtttaa

DBGET integrated database retrieval system